KEGG   Starkeya novella: Snov_3319Help
Entry
Snov_3319         CDS       T01258                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sno  Starkeya novella
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snov_3319
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snov_3319
   00650 Butanoate metabolism
    Snov_3319
  Energy metabolism
   00190 Oxidative phosphorylation
    Snov_3319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3492338..3492748)
Genome map
AA seq 136 aa AA seqDB search
MSTASGSGSSASMRTPRRRVAGLGSARSGTGHFWLQRVTALSNLILVIIALPIVIAVAGE
GHAGVVATLGNPLVAIVLLLLLLSVCMHMRIGMQVVIEDYVHAEGVKVLALIANTFFTTA
VGFAGAFAILKISFGG
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcttccggctccggctcgtccgcttccatgcgcaccccgcgccggcgcgtc
gccggcctcggctcggcgcgctcgggcaccggccatttctggctgcagcgcgtcaccgcg
ctatccaacctgatcctcgtcatcatcgccctgccgatcgtcatcgccgtcgccggcgag
ggccatgcgggggtggtggcgacgctcggcaacccgctggtcgccatcgtgctgctgctg
ctgctgctctccgtctgcatgcacatgcgcatcggcatgcaggtggtcatcgaggactac
gtccatgccgagggcgtgaaggtgctcgcgctgatcgccaataccttcttcacgacagcg
gttggcttcgccggggcgttcgccatcctcaagatcagtttcggaggctga

DBGET integrated database retrieval system