KEGG   Starkeya novella: Snov_3319Help
Entry
Snov_3319         CDS       T01258                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sno  Starkeya novella
Pathway
sno00020  Citrate cycle (TCA cycle)
sno00190  Oxidative phosphorylation
sno00650  Butanoate metabolism
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01130  Biosynthesis of antibiotics
sno01200  Carbon metabolism
Module
sno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sno_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snov_3319
   00650 Butanoate metabolism
    Snov_3319
  Energy metabolism
   00190 Oxidative phosphorylation
    Snov_3319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADH90593
JGI: Snov_3319
UniProt: D7A8Q9
Position
complement(3492338..3492748)
Genome map
AA seq 136 aa AA seqDB search
MSTASGSGSSASMRTPRRRVAGLGSARSGTGHFWLQRVTALSNLILVIIALPIVIAVAGE
GHAGVVATLGNPLVAIVLLLLLLSVCMHMRIGMQVVIEDYVHAEGVKVLALIANTFFTTA
VGFAGAFAILKISFGG
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcttccggctccggctcgtccgcttccatgcgcaccccgcgccggcgcgtc
gccggcctcggctcggcgcgctcgggcaccggccatttctggctgcagcgcgtcaccgcg
ctatccaacctgatcctcgtcatcatcgccctgccgatcgtcatcgccgtcgccggcgag
ggccatgcgggggtggtggcgacgctcggcaacccgctggtcgccatcgtgctgctgctg
ctgctgctctccgtctgcatgcacatgcgcatcggcatgcaggtggtcatcgaggactac
gtccatgccgagggcgtgaaggtgctcgcgctgatcgccaataccttcttcacgacagcg
gttggcttcgccggggcgttcgccatcctcaagatcagtttcggaggctga

DBGET integrated database retrieval system