KEGG   Starkeya novella: Snov_3361Help
Entry
Snov_3361         CDS       T01258                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sno  Starkeya novella
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Snov_3361
Enzymes [BR:sno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Snov_3361
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Snov_3361
Lipid biosynthesis proteins [BR:sno01004]
 Fatty acid synthase
  Component type
   Snov_3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3536420..3537013)
Genome map
AA seq 197 aa AA seqDB search
MLALPAHAAPLRLVALGDSLTAGYGLPASQAFPARLEAALKAGGHDVVIENAGVSGDTTS
AGLARLDWSVPDGTSGVILELGANDMLRGLDPAIAEKSLDAILARLKQRGIPVLLIGMQA
APNLGAAYKQSFDAIYPRLAEKYGVKFYPFLLDGVAGHPNLNQPDGLHPTAAGVDVIVAR
ILPAVEGFLATLPGKAN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctgcccgcgcatgcggcgccgctacgcctcgtggcgctgggcgacagcctc
accgccggctacggcctgcccgccagccaggccttccccgcccggctggaggcggcgctg
aaggccgggggacacgatgtcgtgatcgagaatgccggcgtctccggcgacaccaccagt
gccggcctcgcccgcctcgactggtcggtgccggacggcacgagcggggtgatcctcgaa
ctcggcgccaacgacatgctgcgcgggctcgaccccgccatcgccgagaagtcgctcgac
gccatcctcgcccggctcaagcagcgcggcatccccgtgctgctgatcggcatgcaggcc
gcgcccaatctcggcgccgcctacaagcagagcttcgacgccatctatccgcggctggcc
gagaaatacggcgtgaagttctaccccttcctcctcgacggcgtggccggccaccccaac
ctcaaccagcccgacggccttcaccccaccgccgccggcgtcgatgtcatcgtggcgcgc
atcttaccggcggtggaaggctttcttgccacgctgccgggaaaagcgaactga

DBGET integrated database retrieval system