KEGG   Starkeya novella: Snov_3379Help
Entry
Snov_3379         CDS       T01258                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sno  Starkeya novella
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Snov_3379
Enzymes [BR:sno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Snov_3379
Exosome [BR:sno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Snov_3379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3555345..3556841
Genome map
AA seq 498 aa AA seqDB search
MTYLLAIDQGTTSSRAILFRPDTSVAAQAQQEFPQHFPASGWVEHEAEDLWRTTLATCRA
AMAQVDAKAGDIAAIGITNQRETTVVWDRKSGAAIHRAIVWQDRRTAERCARLRDEGHEP
LVSERTGLILDPYFSGTKIGWILDHVPGARARAERGELAFGTVDSWILWKLTGGKVHATD
ATNAARTLLFNIHTGEWDEELLALLGVPRSLLPEVRDCAADFGTTLPELFDGPIAIGGIA
GDQQAATVGQACFQPGMIKSTYGTGCFALLNTGATAVVSKNRLLTTIAYQLGGKRTYALE
GSIFVAGAAVQWLRDGLGIIKSSAESEALAEAADPAQQVYLVPAFVGLGAPHWDPDVRGA
MFGLTRGSGPAEFALAALESVCYQTADLIDAMRADWAQSGGSRAAPVLRVDGGMAASNFA
MQRLADLLAAPVDRPVIRETTALGAAYLAGHQAGILPEPKRFADSWRLERRFVPSMPTST
REKKLAGWRDAVRRLTMP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacctcctcgccatcgatcagggcaccacctcctcgcgtgccatcctgttccgc
ccggatacctccgtcgccgcgcaggcgcagcaggaattcccgcagcatttccccgcctcc
ggctgggtcgagcacgaggcggaggatttatggcgcaccacgctcgccacctgccgcgcg
gcgatggcgcaggtcgatgccaaggccggcgacatcgccgccatcggcatcaccaaccag
cgcgagaccacggtcgtgtgggaccgcaagagcggcgccgccatccaccgcgccatcgtc
tggcaggaccgccgcaccgccgagcgctgcgcccggctgcgcgacgaagggcacgagccg
ctggtcagcgagcgcaccggcctgatcctcgacccctatttctccggtaccaagatcggc
tggatcctcgaccatgtgcccggcgcgcgggcgcgggccgagcgcggcgagcttgccttc
ggcacggtcgattcgtggatcctgtggaagctcaccggcggcaaggtccacgccaccgac
gccaccaatgccgcgcgcacgctgctgttcaacatccacaccggcgaatgggacgaggag
ctgctggcgctgctgggcgtgccgcgctcgctgctgccggaggtgcgcgactgcgccgcc
gatttcggcaccaccctgccggagctgttcgacggcccgatcgccatcggcggcatcgcc
ggcgaccagcaggcggccaccgtcggtcaggcctgcttccagccgggcatgatcaagtcg
acctacggcaccggctgcttcgccttgctcaacaccggcgcgacggcggtggtctcgaag
aaccgcctgctcaccaccatcgcctatcagctcggcggcaagcgcacctacgcgctggaa
ggctcgatcttcgtcgccggcgccgcggtgcagtggctgcgcgacgggctcggcatcatc
aagagctcggccgagagcgaagcgctggcggaagccgccgatcccgcgcagcaggtctat
ctggtgccggccttcgtcggcctcggggcgccgcactgggatccggacgtgcgcggcgcc
atgttcggcctcacccgcggctccggcccggccgagttcgccctcgcggcgctggagagc
gtctgctaccagaccgccgacctgatcgacgccatgcgcgccgactgggcgcagtcgggc
ggctcgcgcgccgccccggtgctgcgcgtcgacggcggcatggcggcctcgaacttcgcc
atgcaacgcctcgccgacctcctggcggcgccggtcgaccggccggtcatccgcgagacc
acggcgctcggcgccgcctatctcgccggccaccaggccggcatcctgcccgagccgaag
cgcttcgccgattcctggcggctggagcggcgcttcgtcccctccatgcccacctcgacc
cgcgagaagaagctcgccggctggcgcgacgccgtgcgccggctgaccatgccctga

DBGET integrated database retrieval system