KEGG   Starkeya novella: Snov_3673Help
Entry
Snov_3673         CDS       T01258                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sno  Starkeya novella
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Snov_3673
Enzymes [BR:sno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Snov_3673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3879574..3882072
Genome map
AA seq 832 aa AA seqDB search
MTEDNAITPPGGPGGPARWTSSAKVGVGTARTAASRLWFTLSHGILNEIYYPRVDAACTR
DFGFLVTSADGYFAEEKRDADHEVGVLEHGVPAYHLLNTAQDGRWRIQKQIVTDPRREVL
IQQVTFEALIGDIEDYRLFALLAPHLVNAGADNSAWVGDYKGTPMLFATGRQGVSLALAC
SVPWKARSVGYVGASDGWRQLNRDGCLDERYQRAERGNVALSAEVDLAASDGTMLIALGF
GVRPEEAGFRAVSSLTEGFEELRRNYVQGWRAWQHALLPLDHPQSRANINTYRASTIVLA
THQPPSVPGAIIASLSIPWGFNKGDEDLGGYHLVWPRDLVENAGGLLAAGAVDEAKSVLG
YLRAIQEADGHWSQNVWLDGSAYWGGVQMDECAFPILLTDMIRRGGHFAHGELDSYMDMV
ERAATFILRNGPVTGQDRWEEDAGYSPFTLAVEIAALLAAADMMELFGRKEEAVYLRETA
DAWNDSVERWTFATNTELAEKLGVEGYYVRISPVETADAASPLDGFVPVKNRPPADTDRP
AAQLISPDALALVRFGLRAPDDPRILGTVKAIDALLKVELPQGPLWYRYNGDGYGEHEDG
SPFDGTGIGRAWPLLTGERAHYEIAAGNLVRAQQLLVTLEDSAGPGGLLPEQVWDGEDIP
DRELFKGRPSGSAMPLVWAHAEHIKLMRSLKDDKVFDMPPQTVQRYLVDKVTSPRRTWRF
NEKLRSIPAGLKLRIELPAPALIHWSLDGWATTHDTPTTANAFGLHIADLPTTGAPEGRH
LRFTFYWSGADKWEGTDFAVAVDGDDAMFHGSQDPNAPDASRRVAEPAETTK
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggacaacgccatcacgccgccgggcgggcccggcggcccggcgcgctggacg
tcgagcgccaaggtgggcgtcggcaccgcccgcacggcggcgagccggctgtggttcacg
cttagccacggtatcctcaacgagatctactatccgcgcgtcgatgccgcctgcacgcgt
gatttcggcttcctcgtcacctccgcggacggctatttcgccgaggagaagcgcgacgcc
gaccacgaggtcggcgtgctcgagcacggcgtgccggcctatcatttgctcaacacggcg
caggacgggcgctggcgcatccagaagcagatcgtcaccgacccgcgccgcgaggtgctg
atccagcaggtcaccttcgaggcgctgatcggcgacatcgaggattaccggctgttcgcg
ctgctcgcgccgcatctcgtcaatgcgggcgcggacaattccgcctgggtcggcgactac
aagggcacgcccatgctgttcgccaccggccggcagggcgtctcgctcgcgctcgcctgc
tcggtgccatggaaggcgcgctcggtcggctatgtcggcgcctccgacggctggcgccag
ctcaaccgcgacggctgcctcgacgagcgctaccagcgcgccgaacgcggcaatgtcgcg
ctcagcgccgaggtcgacctcgccgccagcgacggcaccatgctgatcgcgctcggcttc
ggcgtgcgcccggaggaagcgggctttcgcgccgtctccagcctcacggagggtttcgag
gagctgcgccggaactatgtgcagggctggcgcgcctggcagcacgcgctgctgccgctc
gaccatccgcagagccgcgccaacatcaacacctaccgcgccagcaccatcgtgctcgcc
acccaccagccgccttccgtgcccggcgccatcatcgccagcctctccattccctggggc
ttcaacaagggcgacgaggatctgggcggctaccacctcgtctggccgcgcgaccttgtc
gagaacgccggcggcctgctcgcagccggcgcggtcgacgaagccaagtccgtgctcggc
tatctccgggcgatccaggaggcggacggccactggtcgcagaatgtctggctggacggc
tccgcctattggggcggcgtgcagatggacgagtgcgccttcccgatcctgctcaccgac
atgatccggcgcggcggccacttcgcccatggcgagctcgactcctacatggacatggtc
gagcgggcggccaccttcatcctgcgcaacggccccgtcaccggccaggaccgctgggag
gaggatgccggctactcgcccttcacgctggcggtggagatcgccgccctgctggccgcc
gccgacatgatggagctcttcggccgcaaggaggaggccgtctatctgcgcgagacggcc
gatgcctggaacgattcggtcgagcgctggaccttcgccaccaacaccgagctggcggag
aagctcggcgtcgagggctattatgtgcgcatctccccggtcgagaccgccgatgctgcc
tccccgctggacggcttcgtgccggtgaagaaccgccccccggccgacaccgaccggccg
gcggcgcagctcatcagccccgacgcgctcgccctcgtgcgcttcggcctgcgggcgccg
gacgatccgcgcatactcggcaccgtcaaggcgatcgacgcgctgctgaaggtggagctg
ccgcagggcccgctctggtaccgctacaatggcgacggctatggcgagcacgaggacggc
tcgcccttcgacggcaccggcatcggccgcgcctggccgctgctgaccggcgagcgcgcc
cattacgagatcgccgccggcaatctcgtgcgcgcgcagcagcttctggtcacgctggag
gattcggccggaccgggcgggctgctgcccgagcaggtctgggacggcgaggacattccc
gatcgcgagctgttcaagggtcggccttccggcagcgccatgccgctggtgtgggcccat
gccgagcacatcaagctgatgcgctcgctgaaggacgacaaggtgttcgacatgccgccg
cagaccgtgcagcgctacctcgtggacaaggtgacctcgccgcgccgcacctggcgcttc
aacgagaagctccgctcgatccccgccggcctcaagctgcgcatcgagctgcccgcgccg
gcgctgatccattggtcgctcgacggctgggccaccacccacgacacgcccaccaccgcg
aacgccttcggcctgcatatcgccgacctgccgacgaccggggcaccggagggcaggcat
ctgcgcttcaccttctactggtccggggcggacaagtgggagggcacggatttcgcggtg
gccgtcgacggcgacgacgcgatgttccacggcagccaggatccgaacgcgcccgacgcc
agccgtcgggtcgccgaacccgccgaaacgacgaagtga

DBGET integrated database retrieval system