KEGG   Streptococcus pneumoniae AP200: SPAP_0106Help
Entry
SPAP_0106         CDS       T01309                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPAP_0106
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPAP_0106
Enzymes [BR:snp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SPAP_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(94259..98218)
Genome map
AA seq 1319 aa AA seqDB search
MQSGGFAMKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTENQPTIHTVSD
SPQSSENRTEETPKAVLQPEAPKTVETETPATDKVASLPKTEEKPQEEVSSTPSDKAEVV
TPTSAEKETANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKAEADKPETEAG
KERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLD
DMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVN
SPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTE
IFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPM
AFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLG
RNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKL
MRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQ
DTIDQAIAKLQETVNNLTLTPEALKEEEAKREVEKLAKNKVISIDAGRKYFTLNQLKRIV
DKASELGYSDVHLLLGNDGLRFLLDDMTITANGKTYASDDVKKAIIEGTKAYYDDPNGTA
LTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKLGIKNPQAHFDKVSKTTMDLK
NEEAMNFVKALIGKYMDFFAGKTKIFNFGTDEYANDATSAQGWYYLKWYQLYGKFAEYAN
TLAAMAKERGLQPMAFNDGFYYEDKDDVQFDKDVLISYWSKGWWGYNLASPQYLASKGYK
FLNTNGDWYYILGQKPEDGGGFLKKAIENTGKTPFNQLASTKYPEVDLPTVGSMLSIWAD
RPSAEYKEEEIFELMTAFADHNKDYFRANYNALREELAKIPTNLEGYSKESLEALDAAKT
ALNYNLNRNKQAELDTLVANLKAALQGLKPAATHSGSLDENEVAANVETRPELITRTEEI
PFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQVVE
VGAPVTHKGDESGLAPTTEVKPRLDIQKEEIPFTTVTRENPLLLKGKTQVITKGVNGHRS
NFYSVSTSADGKEVKTLVNSVVAQEAVTQIVEVGTMVTHVGDENGQAAIAEEKPKLEIPS
QPAPSTAPAEESKALPQDPAPVVTEKKLPETGTHDSAGLVVAGLMSTLAAYGLTKRKED
NT seq 3960 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaggaggttttgcaatgaaacatgaaaaacaacagcgtttttctattcgtaaa
tacgctgtaggagcagcttctgttctaattggatttgccttccaagcacagactgttgca
gccgatggagttactcctactactacagaaaaccaaccgaccatccatacggtttctgat
tcccctcaatcatccgaaaatcggactgaggaaacacctaaagcagtgcttcaaccagaa
gctccaaaaactgtagaaacagaaactccagctactgataaggtagctagtcttccaaaa
acagaagaaaaaccacaagaggaagttagttcaactcctagtgataaagcagaagtggta
actccaacttctgctgaaaaagaaactgctaataaaaaggcagaagaagctagccctaaa
aaggaagaagcgaaagaggttgattctaaagagtcaaatacagacaagactgacaaggat
aaaccagctaaaaaagatgaagcgaaagcagaggctgacaaaccggaaacagaggcagga
aaggaacgtgctgcaactgtaaatgaaaaactagcgaaaaagaaaattgtttctattgat
gctggacgtaaatatttctcaccagaacaactcaaggaaatcatcgataaagcgaaacat
tatggctacactgatttacacctattagtcggaaatgatggactccgtttcatgttggac
gatatgagcatcacagctaacggcaagacctatgccagtgacgatgtcaaacgcgccatt
gaaaaaggtacaaatgattattacaacgatccaaacggcaatcacttaacagaaagtcaa
atgacagatctgattaactatgccaaagataaaggtatcggtctcattccgacagtaaat
agtcctggacacatggatgcgattctcaatgccatgaaagaattgggaatccaaaaccct
aactttagctattttgggaagaaatcagcccgtactgtcgatcttgacaacgaacaagct
gtcgcttttacaaaagcccttatcgacaagtatgctgcttatttcgcgaaaaagactgaa
atcttcaacatcggacttgatgaatatgccaatgatgcgacagatgctaaaggttggagt
gtgcttcaagctgataaatactatccaaacgaaggctaccctgtaaaaggctatgaaaaa
tttattgcctacgccaatgacctcgctcgtattgtaaaatcgcacggtctcaaaccaatg
gcttttaacgacggtatctactacaatagcgacacaagctttggtagttttgacaaagac
atcatcgtttctatgtggactggtggttggggaggctacgatgtcgcttcttctaaacta
ctagctgaaaaaggtcaccaaatccttaataccaatgatgcttggtactacgttcttgga
cgaaacgctgatggccaaggctggtacaatctcgatcaggggctcaatggtattaaaaac
acaccaatcacttctgtaccaaaaacagaaggagctgatatcccaatcatcggtggtatg
gtagctgcttgggctgacactccatctgcacgttattcaccatcacgcctcttcaaactc
atgcgtcattttgcaaatgccaacgctgaatacttcgcagctgattatgaatctgcagag
caagcacttaacgaggtaccaaaagacctgaaccgttatactgcagaaagcgtcacggcc
gtaaaagaagctgaaaaagctattcgctctctcgatagcaaccttagccgtgcccaacaa
gatacgattgatcaagccattgctaaacttcaagaaactgtcaacaacttgaccctcacg
cctgaagctctaaaagaagaagaagctaaacgtgaggttgaaaaacttgccaaaaacaag
gtaatctcaatcgatgctggacgcaaatactttactctgaaccagctcaaacgcatcgta
gacaaggccagtgagctcggatattctgatgtccatctccttctaggaaatgacggactt
cgctttctactcgatgatatgaccattactgccaacggaaaaacctatgctagtgatgac
gttaaaaaagctattatcgaaggaactaaagcttactacgacgatccaaacggtactgca
ctaacacaggcagaagtaacagagctaattgaatacgctaaatctaaggacatcggtctc
atcccagctattaacagtccaggtcacatggatgctatgctggttgccatggaaaaatta
ggtattaaaaatcctcaagcccactttgataaagtttcaaaaacaactatggacttgaaa
aacgaagaagcgatgaactttgtaaaagccctcatcggtaaatacatggacttctttgca
ggtaaaacaaagattttcaactttggtactgacgaatacgccaacgatgcgactagtgcc
caaggctggtactacctcaagtggtatcaactctatggcaaatttgccgaatatgccaac
accctcgcagctatggccaaagaaagagggcttcaaccaatggccttcaacgatggcttc
tactatgaagacaaggacgatgttcagtttgacaaagatgtcttgatttcttactggtct
aaaggctggtggggatataacctcgcatcacctcaatacctagcaagcaaaggctataaa
ttcttgaataccaacggtgactggtactacattcttggtcaaaaaccagaagatggtggt
ggtttcctcaagaaagctattgagaatactggaaaaacaccattcaatcaactagcttct
accaaatatcctgaagtagatcttccaacagtcggaagtatgctttcaatctgggcagat
agaccaagcgctgagtacaaggaagaggaaatctttgaactcatgactgcctttgcagac
cacaacaaagactacttccgtgctaattataatgctctccgcgaagaattagctaaaatt
cctacaaacttagaaggatatagtaaagaaagtcttgaggcccttgacgcagctaaaaca
gctctaaattacaacctcaaccgtaataaacaagctgagcttgacacacttgtagccaac
ctaaaagccgctcttcaaggcctcaaaccagctgcaactcattcaggaagcctggatgaa
aatgaagtggctgccaatgttgaaaccagaccagaactcatcacaagaactgaagaaatt
ccatttgaagttatcaagaaagaaaatcctaacctcccagctggtcaggaaaatattatc
acagcaggagtcaaaggtgaacgaactcattacatctctgtactcactgaaaatggaaaa
acaacagaaacagtccttgatagccaggtaaccaaagaagttataaaccaagtggttgaa
gttggcgctcctgtaactcacaagggtgatgaaagtggtcttgcaccaactactgaggta
aaacctagactggatatccaaaaagaagaaattccatttaccacagtgactcgtgaaaat
ccactcttactcaaaggaaaaacacaagtcattactaagggcgtcaatggacatcgtagc
aacttctactctgtgagcacttctgccgatggtaaggaagtgaaaacacttgtaaatagt
gtcgtagcacaggaagccgttactcaaatagtcgaagtcggaactatggtaacacatgta
ggcgatgaaaacggacaagccgctattgctgaagaaaaaccaaaactagaaatcccaagc
caaccagctccatcaactgctcccgctgaggaaagcaaagctcttcctcaagatccagct
cctgtggtaacagagaaaaaacttcctgaaacaggaactcacgattctgcaggactagta
gtcgcaggactcatgtccacactagcagcctatggactcactaaaagaaaagaagactaa

DBGET integrated database retrieval system