KEGG   Streptococcus pneumoniae AP200: SPAP_0233Help
Entry
SPAP_0233         CDS       T01309                                 

Definition
Holliday junction resolvasome DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:snp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPAP_0233
Enzymes [BR:snp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPAP_0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210250..210843
Genome map
AA seq 197 aa AA seqDB search
MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEAQIYVHQVVREDAHLLY
GFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETKNITYLTKFPKIGKKTA
QQMVLDLEGKVVVAGDGLPAKVAVQASAENQELEEAMEAMLALGYKATELKKIKKFFEGT
TDTAENYIKSALKMLVK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatatttaaaaggaatcattaccaaaattactgccaaatacattgttcttgaa
accaatggtattggttatatcctgcatgtggccaatccttatgcctattcaggtcaggtt
aatcaggaggctcagatttatgtgcatcaggttgtgcgtgaggacgcccatttgctttat
ggatttcgctcagaggatgagaaaaagctctttcttagtctgatttcggtctctgggatt
ggtcctgtatcagctcttgctattatcgctgctgatgacaatgctggcttggttcaagcc
attgaaaccaagaacatcacctacttgaccaagttccctaaaattggcaagaaaacagcc
cagcagatggtgctggacttggaaggcaaggtagtagttgcaggagatggccttcctgcc
aaggtcgcagtgcaagcaagtgctgaaaaccaagaattggaagaagctatggaagccatg
ttggctctgggctacaaggcaacagagctcaagaaaatcaagaaattctttgaaggaacg
acagatacagctgagaactatatcaagtcggcccttaaaatgttggtcaaatag

DBGET integrated database retrieval system