KEGG   Streptococcus pneumoniae AP200: SPAP_0336Help
Entry
SPAP_0336         CDS       T01309                                 

Definition
dihydropteroate synthase-like enzyme
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:snp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
304030..305001
Genome map
AA seq 323 aa AA seqDB search
MKILEGVTDMSSKANHAKTVICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASMLD
IGGESTRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGADLVND
ITGLMGDEKMAHVVAEARAKVVIMFNPVMARPQHPSSLIFPHFGFGQTFTEKELADFETL
PIEDLMVAFFERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDKLHQKGYPIF
LGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVASHRM
AVEIASTIRLADEAENLDLKQYK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccttgagggagtgaccgatatgtcaagtaaagccaatcatgcaaagacagtt
atttgcggaattatcaatgtaaccccagactccttttcggacggtggtcaattttttgct
cttgagcaggcgctccagcaggctcgtaaattgatagcagaaggagccagtatgctagat
atcggcggagaatcgactcggccgggaagtagctatgttgagatagaagaggaaatccag
cgtgttgttccagtgatcaaagcgattcgcaaggaaagtgatgtcctcatctctattgat
acttggaagagtcaagtagcagaggctgctttggctgctggtgccgatctagtcaatgat
atcactggtcttatgggtgatgagaaaatggctcatgtggtagctgaagcgagagcgaaa
gtggtcatcatgtttaacccagttatggctcgacctcagcatcctagttcgcttatcttc
cctcattttggttttggtcaaacctttacagaaaaagagttagctgactttgaaacattg
ccaatcgaagacttgatggtggctttctttgaacgagcactagcgagagcggcagaagct
ggtattgcaccagaaaatatcctgttggatccaggaattggctttggtctgaccaagaaa
gaaaatctgcttcttttacgggacctggataaactacatcagaaaggctatccaatcttt
ctcggagtttcgcgcaagcgatttgtcatcaatatcctagaggagaatggttttgaagtc
aatcctgagacagagcttggtttccgcaatcgggacacggcttcggctcatgtaaccagt
atcgctgcgagacagggtgtagaagtggtgcgcgtgcatgacgtagctagtcacaggatg
gcagttgaaattgcctctactattcgtctggctgatgaagcggaaaatttagatttaaaa
caatataaataa

DBGET integrated database retrieval system