KEGG   Streptococcus pneumoniae AP200: SPAP_0421Help
Entry
SPAP_0421         CDS       T01309                                 

Definition
ATP-dependent exoDNAse (exonuclease V) subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:snp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPAP_0421
Enzymes [BR:snp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SPAP_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(390500..392134)
Genome map
AA seq 544 aa AA seqDB search
MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTGTMADVIEGEDYTFWG
QIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTAQKIVDTYGENTIDEIL
QHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMVLSKLANYGIPNKLAFQIQDFYKEETLD
VVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGLVHSLFQACMETGDTYVEA
RDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQIDTKIFDNSLFFAEEGIRSHL
VRILEKGKQKSHDLETIQKHITTIEEELGIEYDNIQKQAICDAIQNKVFILTGGPGTGKT
TVINGIIAVYALLEGLDFRKKSNLPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDD
DTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNSKILIVGDSDQLPSVSPGQVLAD
LLHIPLIPQTHLEKIYRQSKESTIVTLASQIRQGILPADFTQKKLTVPTLKLLVAIFLPP
LKKS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatttttcaggaaccattgaacggattatttttgaaaatcccagcaatttt
tatcgcatcctcctcctagaaatcgacgatacggacgcagaggattttgatgattttgaa
atcattgtcacaggaaccatggctgatgtaattgagggcgaagactatactttttggggg
caaattgtccagcactccaagtatggagaacaactgcaaatcagtcgttatgatcgcgca
aaaccaactagtaagggcttggtcaagtacttttcaagtagccatttcaaggggattggt
ctcaagacagctcagaaaatcgtggatacctatggcgaaaataccattgacgaaattttg
caacacccagaaaagttagaaggcatcgcaggactctctgccaaaaatcgcgaggctttc
gtctccactctccgtctcaactacggaacggagatggttttgtccaaactagccaactac
ggcattcccaacaaactagcctttcagattcaagacttttacaaggaagaaacccttgat
gtggttgaaaattatccctaccagctggttgaggatatcaagggtttgggctttaccatt
gctgaccaactagctgaggaactaggcatcgaaagtcaggctcctgaacgcttccgcgcc
ggtctagttcacagtctttttcaggcctgtatggaaacaggggacacctatgttgaagca
cgggatttgctggaacaaacccttactctccttgagtcttcccgtcccgtggaactagac
cccagccaagttgcccaagagctctcctacctgatcgaagaagacaaggttcagcagatt
gataccaagatctttgacaacagcctctttttcgctgaggaaggcatccgcagtcacttg
gttcgtatccttgaaaaaggaaaacagaagagtcatgatttagaaaccattcaaaaacat
atcactactatcgaggaagagctgggaattgagtatgataacattcaaaaacaggctatc
tgtgatgctatccagaataaggtctttatcctgacaggtgggcctggtactggtaagaca
actgttatcaatggaatcatcgctgtttatgccctgttagagggacttgacttcaggaag
aaaagcaatctgcctattcttcttgctgctccaactggtcgagctgctcgtcgcatgaat
gaattgacaggtttgcctagcgcgaccatacatcgccacttgggaatgacaggtgacgat
gataccagtcatctggaagattacctagatgctgactttatcatcgtggatgaattctct
atggtagatacttggctggccaatcaactcttctccaatatctcttctaacagtaagatc
ctcatcgtaggtgacagtgatcagctaccttctgtcagtcctggacaggttctagcggat
ctgcttcatattcctttgattcctcagactcacttggaaaaaatttatcgacaaagcaaa
gaatcaaccatcgtcaccctagctagtcagattcgacagggcatcttgccagctgatttc
acccaaaaaaagctgaccgttcctactttgaaattgctagtggccatattcctgccacca
ttgaaaaaatcttag

DBGET integrated database retrieval system