KEGG   Streptococcus pneumoniae AP200: SPAP_0635Help
Entry
SPAP_0635         CDS       T01309                                 

Definition
beta-galactosidase/beta-glucuronidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPAP_0635
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPAP_0635
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPAP_0635
Enzymes [BR:snp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPAP_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602887..609588
Genome map
AA seq 2233 aa AA seqDB search
MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYADETLITHTAEKPKEE
KMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTPKEEKVSAKLEEKAPRI
ESQASSQEKPLKEDAKAVTNEEMNQMIEDRKVDFNQNWYFKLNANSKEAIKPDADVSTWK
KLDLPYDWSIFNDFDHESPAQNEGGQLNGGEAWYRKTFKLDEKDLKKNVRLTFDGVYMDS
QVYVNGQLVGHYPNGYNQFSYDITKYLQKDGRENVIAVHAVNKQPSSRWYSGSGIYRDVT
LQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIINTDDKDHELVAEYQIVERGGHA
VTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKPALYELITRVYRDGQLVDAKKD
LFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGAEENYKAEYRRLKQMKEMGVNSI
RTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPYDYGRFFEKDATHPEARKGEKWSD
FDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLATVKRLVKVIKDVDKTRYVTMGADK
FRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAKHPKWLIYGSETSSATRTRGSYYRPE
RELKHSNGPERNYEQSDYGNDRVGWGKTATASWTFDRDNAGYAGQFIWTGTDYIGEPTPW
HNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQWVSVKKKPMVHLLPHWNWENKELASKVA
DSEGKIPVRAYSNASSVELFLNGKSLGLKTFNKKQTSDGRTYQEGANANELYLEWKVAYQ
PGTLEAIARDESGKEIARDKITTAGKPAAVRLIKEDHAIAADGKDLTYIYYEIVDSQGNV
VPTANNLVRFQLHGQGQLVGVDNGEQASRERYKAQADGSWIRKAFNGKGVAIVKSTEQAG
KFTLTAHSDLLKSNQVTVFTGKKEGQEKTVLGTEVPKVQTIIGEAPEMPTTVPFVYSDGS
RAERPVTWSSVDVSKPGIVTVKGMADGREVEARVEVIALKSELPVVKRIAPNTDLNSVDK
SVSYVLTDGSVQEYEVDSWEIAEEDKAKLAIPGSRIQATGYLEGQPIHATLVVEEGNPAA
PVVPTVTVGGEAVTGLTSRQPMQYRTLSYGAQLPEVTASAENADVTVLQASAANGMRAII
FIQPKDGGPLQTYAIQFLEEAPKIAHLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLP
ADKVTFSTSGEGEVAIRKGMLELHKPGAVTLKAEYEGATGQITLTIQANTEKKIAQSIRP
VNVVTDLHQKPTLPTTVTVEYDKGFPKAHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEA
RAKVSVEGIVSVEEVSVTTPIAEAPQLPESVRTYDSNGHVSSAKVAWDAIRIEQYAKEGV
FTVNGRLEGTQLTTKLHVRVSAQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKL
ISYNNQPANRWTNWNRSNPEASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIE
YYVGKTVPTAPKNPSFVGNEDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAI
RIRMVKADNKRGTSITEVQIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGK
VPAVTANVSNNGLATVVPSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSHKPVAAV
KQARLLQVGQALELPTKVPVYFTGKDGYETKDLSVEWEEVPAENLTKAGQFTVRGHVLGS
DLVAEVTVRVTDKLGEALSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRR
WTNWSPTPSSNPEVSAGVIFRENGKIVERTVAQAKLHFFADSGTDAPTKLVLERYVGPEF
EVPTYYSNYQAYDADHPFNNPENWEAVPYRADKDIAAGDEINVTFKAVKAKAMRWRMERK
ADKSGVAMIEMTFLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEE
NNQVASTVVDSGEDSLPVLVRLVSESGKQVKEYRIHLTKEKPVSEKTVAAVQEDLPKLEF
VEKDLAYKTVEKKDSTLYLGETRVEQEGKTGKERIFTAINPDGSKEEKLREVVEAPTDRI
VLVGTKPVAQEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSASSQAAVAAGLALLGL
SAGLVVTKGKKED
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggccattggaatcggaaaagagtttatagcattcgtaagtttgctgtggga
gcttgctcagtaatgattgggacttgtgcagttctattaggaggaaatatagctggagaa
tctgtagtttatgcggatgaaacacttattactcatactgctgagaaacctaaagaggaa
aaaatgatagtagaagaaaaggctgataaagctttggaaactaaaaatgtagttgaaagg
acagaacaaagtgaacctagttcaactgaggctattgcatctgagaagaaagaagatgaa
gccgtaactccaaaagaggaaaaagtgtctgctaaactggaagaaaaagctccaaggata
gaatcacaagcttcaagtcaagaaaaaccgctcaaggaagatgctaaagctgtaacaaat
gaagaaatgaatcaaatgattgaagacaggaaagtggattttaatcaaaattggtacttt
aaactcaatgcaaattctaaggaagccattaaacctgatgcagacgtatctacgtggaaa
aaattagatttaccgtatgactggagtatctttaacgatttcgatcatgaatctcctgca
caaaatgaaggtggacagctcaacggtggggaagcttggtatcgcaagactttcaaacta
gatgaaaaagacctcaagaaaaatgttcgccttacttttgatggcgtctacatggattct
caagtttatgtcaatggtcagttagtggggcattatccaaatggttataaccagttctca
tatgatatcaccaaataccttcaaaaagatggtcgtgagaatgtgattgctgtccatgca
gtcaacaaacagccaagtagccgttggtattcaggaagtggtatctatcgtgatgtgact
ttacaagtgacagataaggtgcatgttgagaaaaatgggacaactattttaacaccaaaa
cttgaagaacaacaacatggcaaggttgaaactcatgtgaccagcaaaatcatcaatacg
gacgacaaagaccatgaacttgtagccgaatatcaaatcgttgaacgaggtggtcatgct
gtaacaggcttagttcgtacagcgagtcgtaccttaaaagcacatgaatcaacaagccta
gatgcgattttagaagttgaaagaccaaaactctggaccgttttaaatgacaaacctgcc
ttgtacgaattgattacgcgtgtttaccgtgacggtcaattggttgatgctaagaaggat
ttgtttggttaccgttactatcactggactccaaatgaaggtttctctttgaatggtgaa
cgtattaaattccatggagtatccttgcaccacgaccatggggcgcttggagcagaagaa
aactataaagcagaatatcgccgtctcaaacaaatgaaggagatgggagttaactccatc
cgtacaacccacaaccctgctagtgagcaaaccttgcaaatcgcagcagaactaggttta
ctcgttcaggaagaggcttttgatacttggtatggtggcaagaaaccttatgactatgga
cgtttttttgaaaaagatgccactcacccagaagctcgaaaaggtgaaaaatggtctgat
tttgacctacgtaccatggtcgaaagaggcaaaaacaaccctgctatcttcatgtggtca
attggtaatgaaataggtgaagctaatggtgatgcccactctttagcaactgttaaacgt
ttggtcaaggttatcaaggatgttgataagactcgctatgttaccatgggagcagataaa
ttccgtttcggtaatggtagcggagggcatgagaaaattgctgatgaactcgatgctgtt
ggatttaactattctgaagataattacaaagcccttagagctaagcatccaaaatggttg
atttatggatcagaaacatcttcagctacccgtacacgtggaagttactatcgccctgaa
cgtgaattgaaacatagcaatggacctgagcgtaattatgaacagtctgactatgggaat
gatcgtgtgggttgggggaaaacagcaaccgcttcatggacttttgaccgtgacaacgct
ggctatgctggacagtttatctggacaggtacggattatattggtgaacctacaccatgg
cacaaccaaaatcaaactcctgttaagagctcttactttggtatcgtagatacagccggc
attccaaaacatgacttctatctctaccaaagccaatgggtttctgttaagaagaaaccg
atggtacaccttcttcctcactggaactgggaaaacaaagaattagcatccaaagtagct
gactcagaaggtaagattccagttcgtgcttattcgaatgcttctagtgtagaattgttc
ttgaatggaaaatctcttggtcttaagactttcaataaaaaacaaaccagcgatgggcgg
acttaccaagaaggtgcaaatgctaatgaactttatcttgaatggaaagttgcctatcaa
ccaggtaccttggaagcaattgctcgtgatgaatctggcaaggaaattgctcgagataag
attacgactgctggtaagccagcggcagttcgtcttattaaggaagaccatgcgattgca
gcagatggaaaagacttgacttacatctactatgaaattgttgacagccaggggaatgtg
gttccaactgctaataatctggttcgcttccaattgcatggccaaggtcaactggtcggt
gtagataacggagaacaagccagccgtgaacgctataaggcgcaagcagatggttcttgg
attcgtaaagcatttaatggtaaaggtgttgccattgtcaaatcaactgaacaagcaggg
aaattcacccttactgcccactctgatctcttgaaatcgaaccaagtcactgtctttact
ggtaagaaagaaggacaagaaaagactgttttggggacagaggtgccaaaagtacagacc
attattggagaggcacctgaaatgcctaccactgttccgtttgtatacagtgatggtagc
cgtgcagaacgtcctgtaacctggtcttcagtagatgtgagcaagcctggtattgtaacg
gtgaaaggtatggctgacggacgagaagtagaagctcgtgtagaagtgattgctcttaaa
tcagagctaccagttgtgaaacgtattgctccaaatactgacttgaattctgtagacaaa
tctgtttcctatgttttgactgatggaagtgtacaagagtacgaagtagatagctgggag
attgccgaagaagataaagctaagttagcaattccaggttctcgtattcaagcgaccggt
tatttagaaggtcaaccaattcatgcaacccttgtggtagaagaaggcaatcctgcagca
cctgtagtgccaactgttactgttggaggtgaagcagtaacaggtcttactagtcgacaa
ccaatgcaatatcgtactctatcttatggtgcccaattgccagaagtcacagcaagtgct
gaaaatgctgatgtgacagttcttcaagcaagcgcagcaaacggcatgcgtgcgatcatc
tttattcagcctaaagatggtggccctcttcaaacctatgcaattcaattccttgaagaa
gcgccaaaaattgctcacttgagcttgcaagtggaaaaagctgacagtctcaaagaagac
caaactgtcaaattgtcggttcgagctcactatcaagatggaacgcaagctgtattacca
gctgataaagtaaccttctctacaagtggtgaaggggaagtcgcaattcgtaaaggaatg
cttgagttgcataagccaggagcagtcactctcaaagcggaatatgagggagctacaggt
caaatcactctcactatccaagccaatactgagaagaagattgcgcaatctatccgtcct
gtaaatgtagtcacagatttgcatcaaaaacctactcttccaacaacagtaacggttgag
tatgacaaaggtttccctaaagctcacaaagtcacttggcaagctattccgaaagaaaaa
ctagactcttatcaaacatttgaagtactaggtaaagttgaaggaattgaccttgaagcg
cgtgcaaaagtctctgtagaaggtatcgtttcagttgaagaagtcagtgtgacaactcca
atcgcagaagcaccacaattaccagaaagcgttcggacatatgattcaaatggtcacgtt
tcatcagctaaggttgcatgggatgcgattcgtatagagcaatacgctaaggaaggtgtc
tttacagttaatggtcgcttagaaggtactcaattaacaactaaacttcatgttcgcgta
tctgctcaaactgagcaaggtgcaaacatttctgaccaatggaccggttcagaattgcca
cttgcctttgcttcagattcaaatccaagcgacccagtttcaaatgttaatgacaagctc
atttcctacaataaccaaccagccaatcgttggacaaactggaatcgtagtaatccagaa
gcttcagtcggtgttctgtttggagattcaggtatcttgagcaaacgctccgttgataat
ctaagtgtcggattccacgaagaccatggagttggtgcaccgaagtcttatgtgattgag
tattatgttggtaagactgtcccaacagctcctaaaaaccctagttttgttggtaatgag
gaccatgtctttaatgattctgccaactggaaaccagttactaatctaaaagcccctgct
caactcaaggctggagaaatgaaccactttagctttgataaagttgaaacctatgctatt
cgtattcgcatggttaaagcagataacaagcgtggaacgtctatcacagaggtacaaatc
tttgcgaaacaagttgcggcagccaaacaaggacaaacaagaatccaagttgacggcaaa
gacttagcaaacttcaaccctgatttgacagactactaccttgagtctgtagatggaaaa
gttccggcagtcacagcaaatgttagcaacaatggtctcgctaccgtcgttccaagcgtt
cgtgaaggtgagccagttcgtgtcatcgcgaaagctgaaaatggcgacatcttaggagaa
taccgtctgcacttcactaaggataagaacttactttctcataaaccagttgctgcggtt
aaacaagctcgcttgctacaagtaggtcaagcacttgaattgccgactaaggttccagtt
tacttcacaggtaaagacggctacgaaacaaaagatttgtcagttgaatgggaagaagtt
ccagcagaaaatctgacaaaagcaggtcaatttaccgttcgaggccatgtccttggtagt
gatcttgttgctgaggtcactgtacgagtgacagacaaactaggcgaagctctttcagat
aaccctaactatgatgaaaacagtaaccaggcctttgcttcagcaaccaatgatattgac
aaaaactctcatgaccgcgttgactatctcaatgacggagatcattcagaaaatcgtcgt
tggacaaactggtctccaacaccatcttctaatccagaagtatcagcgggtgtgatcttc
cgtgaaaatggtaagattgtagaacggactgttgcgcaagccaaacttcacttctttgca
gatagtggtacggatgcaccaactaaactcgttttagaacgctatgtcggtccagagttt
gaagtgccaacctactattcaaactaccaagcctacgacgcagaccatccattcaacaat
ccagaaaattgggaagctgtgccttatcgtgcggataaagacatcgcagctggtgatgaa
atcaacgtaacatttaaagctgtcaaagccaaagctatgagatggcgtatggagcgtaaa
gcagataagagcggtgttgcgatgattgagatgaccttccttgcaccaagtgaattgcct
caagaaagcacgcaatcgaagattcttgtagatggaaaagaacttgctgatttcgctgaa
aatcgtcaagactatcaaattacctataaaggtcaacggccaaaagtctcagttgaagaa
aacaatcaagtagcttcaactgtggtagatagtggagaagatagccttccagtacttgtt
cgcctcgtttcagaaagtggaaaacaagtcaaggaataccgtatccacttgactaaggaa
aaaccagtttctgagaagacagttgctgctgtacaagaagatcttccaaaactcgaattt
gttgaaaaagatttggcctacaagacagttgagaaaaaagattcaacactgtatctaggt
gaaactcgtgtagaacaagaaggaaaaactggtaaagaacgtatctttacagcgattaat
cctgatggaagtaaggaagaaaaactccgtgaagtggtagaagctccgacagaccgcatc
gtcttggttggaaccaaaccagtagctcaagaagctaaaaaaccacaagtgtcagaaaaa
gcagatacaaaaccaattgattcaagtgaagctagtcaaactaataaagcccagttacca
aatacaggtagtgcgtcaagccaagcagcagtagcagcaggtttagctcttctaggtttg
agtgcaggattagtagttactaaaggtaaaaaagaagactag

DBGET integrated database retrieval system