KEGG   Streptococcus pneumoniae AP200: SPAP_0657Help
Entry
SPAP_0657         CDS       T01309                                 

Definition
(GenBank) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
snp00010  Glycolysis / Gluconeogenesis
snp00052  Galactose metabolism
snp00500  Starch and sucrose metabolism
snp00520  Amino sugar and nucleotide sugar metabolism
snp00521  Streptomycin biosynthesis
snp01100  Metabolic pathways
snp01110  Biosynthesis of secondary metabolites
snp01120  Microbial metabolism in diverse environments
snp01130  Biosynthesis of antibiotics
snp01200  Carbon metabolism
Module
snp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAP_0657
   00052 Galactose metabolism
    SPAP_0657
   00500 Starch and sucrose metabolism
    SPAP_0657
   00520 Amino sugar and nucleotide sugar metabolism
    SPAP_0657
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPAP_0657
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SPAP_0657
Enzymes [BR:snp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPAP_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADM84250
Position
633177..634136
Genome map
AA seq 319 aa AA seqDB search
MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLGL
AAADFQGIGMGSPGVVDREKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAAL
GERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPIACTCG
KKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagattattgggattgaccttggtggaacttctatcaaatttgcaatctta
acaacagcaggagaaatccaaggaaaatggtcaatcaagaccaacattttggatgaggga
agtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttggattg
gcagcagcagacttccaaggtattggaatgggatcaccaggtgttgttgaccgtgaaaaa
gggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaaaag
attgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagctctt
ggtgagcgctggatgggtgctggtgataaccaaccagatgttgtctttatgacactcggt
actggtgttggtggtggtattgtcgcagaaggcaaattgcttcatggtgttgctggtgca
gcaggtgaacttggtcatatcactgttgattttgaccaaccaattgcatgtacttgtggt
aaaaaaggctgccttgagacagttgcttcagcaacaggaattgtcaacttgactcgtcgc
tatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataacggagaagaa
gtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgattgtt
taccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatcctaaac
ccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaaggt
gttcaaaaagtttacgatgaaaatagtttcccacaagtacgcacatctactaaattagct
cttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaataa

DBGET integrated database retrieval system