KEGG   Streptococcus pneumoniae AP200: SPAP_0711Help
Entry
SPAP_0711         CDS       T01309                                 

Definition
beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:snp00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
681032..681313
Genome map
AA seq 93 aa AA seqDB search
MDTPDENGYVADDYRITYLEAHIKAMRDAIYKDGVDLLGYTTWGCIDSVSAGTGEMNKRY
GFIYVDRDNVGNGTLKRSKKKSFYWYMSFIAMV
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggatacaccggatgagaatggttatgtagcagatgactatcggattacttacttagag
gcccacatcaaggccatgcgagatgccatttacaaagacggggttgacttgcttggttat
acgacatggggctgtatcgattcggtttcagctggcacaggggaaatgaataagcgctat
ggctttatctatgtagatcgagataatgtaggaaatgggactctcaaacgtagcaagaag
aagtccttctattggtacatgtcatttatagcaatggtgtaa

DBGET integrated database retrieval system