KEGG   Streptococcus pneumoniae AP200: SPAP_1073Help
Entry
SPAP_1073         CDS       T01309                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:snp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1022638..1024566)
Genome map
AA seq 642 aa AA seqDB search
MDNREALKTFMTGENFYLQHYLGAHREELNGEHGYTFRVWAPNAQAVHLVGDFTNWIENQ
IPMVRNDFGVWEVFTNMAQEGHIYKYHVTRQNGHQLMKIDPFAVRYEARPGTGAIVTELP
DKKWRDGLWLARRKRWGFVERPVNIYEVHAGSWKRNPDGSPYSFAQLKDELIPYLVEMNY
THIEFMPLMSHPLGLSWGYQLMGYFALEHAYGRPEEFQDFVEECHTHNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHNKAHNHGWGALNFDLGKNEVQSFLISCIKHWIDVYHLDG
IRVDAVSNMLYLDYDNAPWTPNKDGGNLNYEGYYFLQRLNEVIKLEYPDVMMIAEESSSA
TKITGMKEIGGLGFDYKWNMGWMNDILRFYEEDPIYRKYDFNLVTFSFMYVFKENYLLPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEYGQFLEWKSEEQ
LEWSNLEDPMNAKMKYFTSQLNQFYKDHRCLWEIDTSYDGIEIIDADNRDQSVLSFIRKG
KKGEMLVCIFNMVPVERKDFTIGLPVAGIYEEVWNTELEEWGGVWKEHNQTVQTQEGLWK
DYEQTLTFTLPAMGASVWKIKRRLKSTKTVTNKNQKGVENEK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggataatagagaagcattaaaaacctttatgacgggtgaaaatttttatctccaacat
tatctaggagcacatagggaagaactaaatggagagcatggctataccttccgtgtttgg
gcacctaatgctcaggctgttcacttggttggtgattttaccaactggattgaaaatcag
attccaatggtaagaaatgactttggggtctgggaagtctttaccaatatggctcaagaa
gggcatatttacaaatatcatgtcacacgtcaaaatggtcatcaactgatgaagattgac
ccttttgctgtcaggtatgaggctcgtccaggaacaggggcaatcgtaacagagcttcct
gataagaaatggagggatggactttggctggcacgaagaaaacgttggggctttgttgaa
cgtcctgtcaatatttacgaggttcatgctggctcttggaagagaaatcctgatggcagt
ccttatagttttgcccagctcaaggatgaactcattccttatctcgttgaaatgaactat
actcatattgagtttatgcccttgatgtcccatcctttgggcttgagttgggggtatcag
cttatgggttacttcgctttagagcatgcttatggcagaccagaggagtttcaagatttt
gtcgaggagtgtcatacccataatattggggttattgtggactgggtaccaggtcacttt
accatcaacgatgatgccttagcctattatgatgggacaccgacttttgaataccaagac
cataataaggctcataaccatggttggggtgcccttaattttgaccttggaaaaaatgaa
gtccagtccttcttaatttcttgcattaagcattggattgatgtctatcatttggatggt
attcgtgtggatgctgttagcaacatgctctatttggactatgataatgctccatggaca
cctaataaagatggcggaaatcttaactatgaaggttattattttcttcaacgcttgaat
gaagttattaagttagaatatccagatgtgatgatgattgcagaagaaagttcgtctgcg
accaagattacgggaatgaaagagattggtggtctaggatttgactacaaatggaacatg
ggctggatgaatgatatcctccgtttctacgaagaagatccgatttatcgtaaatatgac
tttaacctggtgactttcagctttatgtatgttttcaaggagaattatctcttgccattc
tcgcacgatgaagtggttcatggcaagaagagtatgatgcataagatgtggggagatcgt
tacaatcaattcgcaggcttgcgcaatctctatacgtaccaaatttgtcaccctggtaag
aaattgctcttcatgggtagcgaatacggtcaattcctagaatggaaatctgaagaacag
ttggaatggtctaacctagaagacccaatgaatgctaagatgaagtatttcacttctcag
ctaaaccagttttacaaagatcatcgctgtctgtgggaaatcgataccagctatgatggt
attgaaatcattgatgcggataatcgagaccagagtgttctttcctttattcgtaagggt
aaaaagggagaaatgttagtctgtatctttaacatggtacctgttgagcggaaagatttt
acaatcggactacccgttgcaggaatttacgaagaagtatggaatactgagttggaagag
tggggaggcgtttggaaagaacataatcaaactgttcaaacgcaagaaggcctatggaaa
gattatgagcagaccttaacctttactctaccggctatgggagcaagtgtatggaaaatc
aaacgtcgcttgaaatctactaaaaccgtcacaaataaaaaccaaaaaggagtagaaaat
gaaaaataa

DBGET integrated database retrieval system