KEGG   Streptococcus pneumoniae AP200: SPAP_1302Help
Entry
SPAP_1302         CDS       T01309                                 

Definition
aspartate carbamoyltransferase catalytic chain
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPAP_1302
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPAP_1302
Enzymes [BR:snp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SPAP_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1241277..1242200)
Genome map
AA seq 307 aa AA seqDB search
MSENQQALNHVVSMEDLTVDQVMKLIKRGIEFKNGAQLPYEDHPIVSNLFFEDSTRTHKS
FEVAEIKLGLERLDFDVKTSSVNKGETLYDTILTLSALGVDVCVIRHPEVDYYRELIASP
TITTSIINGGDGSGQHPSQSLLDLMTIYEEFGHFEGLKVAIAGDLDHSRVAKSNMQILKR
LGAELFFAGPEEWRSQEFADYGQFVTIDEIIDQVDVMMFLRVQHERHDSGAVFSKEDYHA
QHGLTQERYDRLKETAILMHPAPINRDVEIADHLVEAPKSRIVQQMTNGVFVRMAILESV
LASRNAN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatcaacaagcattgaaccatgtggtgtccatggaagacctcactgtcgat
caagtaatgaaattgatcaagcgaggaattgagtttaaaaatggagcccagcttccctat
gaagaccatccgattgtttccaatctcttctttgaggattctacacggacacataagtcc
tttgaagtcgcagagattaaacttggattggaacgacttgactttgatgtgaagactagc
tcggttaataagggtgagacactttatgacaccattttgactctgtctgctttaggagtg
gatgtctgtgtgattcgccatccagaggtcgactactatagagaattgattgctagtcca
acgattacgacttccatcatcaatggtggagatggttcgggccaacaccctagccagagc
ttgcttgatttgatgaccatttatgaggaatttggccactttgagggtcttaaagttgct
attgcaggtgacttggaccactcacgcgttgccaaatccaatatgcagattttgaaacgc
ttgggagctgaactctttttcgctggacctgaggaatggagaagtcaagagtttgcagac
tatggacagtttgtaaccattgatgaaatcattgatcaggttgatgtcatgatgtttctc
cgtgtgcaacacgaacgccatgatagtggagctgtattttcaaaagaagactaccatgcc
caacatggcttgactcaagaacgttacgatcgtttgaaagaaacagcaatcctcatgcac
ccagctccaatcaatcgtgatgtagaaatagcagaccacttggttgaagcaccaaaatca
cggattgtccaacaaatgaccaatggtgtctttgttcgaatggcaatcttagaatccgta
ctagcgagtagaaacgccaactaa

DBGET integrated database retrieval system