KEGG   Streptococcus pneumoniae AP200: SPAP_1592Help
Entry
SPAP_1592         CDS       T01309                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPAP_1592
   00670 One carbon pool by folate
    SPAP_1592
Enzymes [BR:snp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SPAP_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1499969..1500475)
Genome map
AA seq 168 aa AA seqDB search
MTKKIVAIWAQDEEGVIGKENRLPWHLPAELQHFKETTLNHAILMGRVTFDGMGRRLLPK
RETLILTRNPEEKIDGVATFQDVQSVLDWYQAQEKNLYIIGGKQIFQAFEPYLDEVIVTH
IHARVEGDTYFPEELDLSLFETVSSKFYAKDEKNPYDFTIQYRKRKEV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaaaatcgtagctatttgggcccaggatgaagagggtgtgattggtaaggaa
aatcgtctgccttggcatttgccagcagaattgcagcactttaaagaaacaactctgaat
catgctatcttgatggggcgtgtgacctttgatgggatggggcgtcgcttgcttccaaaa
cgggaaaccttgattttgacgcgtaatccggaagaaaagatagatggggttgctactttt
caggacgtccagtctgttcttgactggtatcaggctcaagaaaagaatctctacattatc
ggtgggaagcaaatttttcaggcttttgaaccttaccttgatgaagtgattgtcactcac
attcatgctcgggtggaaggagatacctatttccctgaagaacttgacttgtctcttttt
gagacagtttcaagcaaattttacgccaaagatgagaagaatccttatgattttaccatc
caataccgcaagagaaaggaagtctaa

DBGET integrated database retrieval system