KEGG   Streptococcus pneumoniae AP200: SPAP_1663Help
Entry
SPAP_1663         CDS       T01309                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPAP_1663
   01230 Biosynthesis of amino acids
    SPAP_1663
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAP_1663
  Energy metabolism
   00680 Methane metabolism
    SPAP_1663
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAP_1663
Enzymes [BR:snp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPAP_1663
Exosome [BR:snp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPAP_1663
  Exosomal proteins of melanoma cells
   SPAP_1663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1565603..1566295)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPNMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcgattgacgctggt
aaattgatcaaagaagctggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gctatcaaaacaactaacttggctcttgaagcttctgaccaattatgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaacaaagctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaatatggaccgtgatgatgagcactcagctcacacagaccgtcgttatgcttca
cttgacgactcagtaatcccagatgctgaaaacttgaaagtgactttggaacgtgctctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaaggtttgtcagatgatgag
atcatggacgtggaaatccctaacttcccaccattggtattcgaattcgacgaaaaattg
aacgttgtttctgaatactaccttggaaaataa

DBGET integrated database retrieval system