KEGG   Streptococcus pneumoniae AP200: SPAP_1677Help
Entry
SPAP_1677         CDS       T01309                                 

Definition
recombinational DNA repair ATPase
Orthology
K06187  
recombination protein RecR
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:snp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPAP_1677
DNA repair and recombination proteins [BR:snp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SPAP_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1580762..1581358)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSIC
GRLTDDDPCSICTDPTRDQTTILVLEDSRDVAAMENIQEYHGLYHVLHGLISPMNGISPD
DINLKSLMTRLMDSEVSEVIVATNATADGEATSMYLSRLLKPAGIKVTRLARGLAVGADI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatccaacacctattgccaagttgattgacagttattctaagttaccaggtatc
gggattaagacggctacgcgtctggccttttatacgattgggatgtctgctgatgatgtc
aatgaatttgcaaaaaatctcctttctgctaagagagaattgacatattgttctatttgt
ggacgtttgacagacgacgatccttgttctatctgtactgatccgactcgtgaccagaca
acaattttagttcttgaggatagtagagatgtggcagccatggaaaatatccaagaatac
catggactctatcatgtccttcatggcctcatttctcctatgaatggtatcagtccggac
gatatcaatctcaagagccttatgactcgtcttatggatagtgaagtttcagaagtgatt
gtggcgactaatgctacagcggatggtgaagcgacttccatgtatctttcacgtttgctc
aagccggctggtatcaaggttacgcgtctagcacgaggtctcgctgtgggagcggacatt
gagtatgcggacgaagtgacactcttacgagcgattgaaaatcggacagagttgtaa

DBGET integrated database retrieval system