KEGG   Streptococcus pneumoniae AP200: SPAP_1810Help
Entry
SPAP_1810         CDS       T01309                                 

Definition
(GenBank) hypothetical protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
snp00260  Glycine, serine and threonine metabolism
snp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
snp01100  Metabolic pathways
snp01110  Biosynthesis of secondary metabolites
snp01130  Biosynthesis of antibiotics
snp01230  Biosynthesis of amino acids
Module
snp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAP_1810
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPAP_1810
Enzymes [BR:snp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPAP_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: ADM85393
Structure
PDB: 

Jmol
Position
complement(1704205..1704981)
Genome map
AA seq 258 aa AA seqDB search
MPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLDGLGETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQALVETLKTIKTEIPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPDLPHEHANFVEPFLADTDITLIPLVSLTTGIERQKELIEGAEGFVYAVAIN
GVTGKSGNYRADLDKHLAQLHQVADIPVLTGFGVSSQADLERFNAVSDGVIVGSKIVKAL
HQGEPIQDFIKQAVAYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacagaaaaattaaatgctataaaagcagctggaaaaggaattttt
gttccctatatcatggctggagaccacgagaaaggtttggatggactaggagaaacaatc
cactttttagaagatttgggtgtctctgcaattgaagtgggtattcccttttcagaccct
gttgcagatggacctgttatcgaagaagctggcttgcgcagtttagcccacgggacctct
acccaggctttagttgaaaccttgaaaaccattaaaacagagattccactggtcatcatg
acctacttcaaccccctctttcagtacggtgtggagaactttgtcaaagatctggctgat
acagctgtgaagggcttgattatcccagacttgcctcatgaacatgccaactttgtagaa
ccatttttggcagatacagatatcaccttgattcctttagtaagcttgaccacaggaatt
gagcgccagaaagagttgattgaaggggcggagggattcgtctatgccgttgccatcaat
ggagtgacagggaaatcaggcaattaccgtgcagatttggacaagcacttggcgcaactt
catcaagtggccgacatcccagtcttgacaggttttggtgtatctagtcaagccgatctg
gaacgcttcaatgcggtgtcagatggtgttatcgtcggttcgaaaatagtaaaagctctc
caccaaggagagccgattcaggactttatcaaacaagcagtagcttaccaaaaataa

DBGET integrated database retrieval system