KEGG   Streptococcus pneumoniae AP200: SPAP_1811Help
Entry
SPAP_1811         CDS       T01309                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPAP_1811
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAP_1811
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPAP_1811
Enzymes [BR:snp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPAP_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1704974..1706197)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDLTGRDLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGAEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaggaaccaaataaagatggattttacggaaaattcggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctaccgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccaacttttgcgccagtatgtgggacgtgaaact
cccctttactacgcaaaaaatttgacccagcatatcggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttaggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaacgggtgctggtcagcacggt
gtggcaactgcaactgctgcggccctctttaacatggaatgtaccatctacatgggtgag
gaagatgtcaaacgccaagccctcaatgtcttccgtatggagcttttgggagctaaggtc
gaggccgtgacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtggctaatatcgacgatacccactatatccttggttctgccttggggcctcatcca
tttccagaaatcgttcgtgacttccaaagtgtcatcggtcgagaggctaaacaacagtac
cgtgacttgacaggtcgagatctgccagatgccctagtagcctgtgttggtggtggatct
aatgctattgggctcttccatccctttgtagaagatgagtcagtagccatgtatggagct
gaagcggctgggcttggtgtggatacagagcaccacgctgctaccttgaccaagggtcgt
ccgggtgttcttcacggttctctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatatcaaacgtgccagctatgtccctgtgacagacgaagaagctttggaagga
tttcaactcttgtctcgtgtggaagggattatcccagccttggaatctagccatgctatc
gcttttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtatgccta
tcaggtcgtggggacaaggatgtggttcaagtcaaagaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system