KEGG   Streptococcus pneumoniae AP200: SPAP_2138Help
Entry
SPAP_2138         CDS       T01309                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPAP_2138
   00052 Galactose metabolism
    SPAP_2138
   00500 Starch and sucrose metabolism
    SPAP_2138
   00520 Amino sugar and nucleotide sugar metabolism
    SPAP_2138
Enzymes [BR:snp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPAP_2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1977685..1978584
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDEATGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMNDYEKTHASTIAVMPVPHEDVSSYGVIAPQ
DEGKDGLYSVETFVEKPAPEETPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAID
TLNKTQRVFARKFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYLIQLGKELTEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagttatccctgctgctggactaggaactcgattttta
ccagcaaccaaggcccttgccaaagaaatgttgccaatcgtagacaaaccaactatccag
tttatcgtggaagaggctctcaaatcaggtattgaagatattctagttgtcactggtaaa
tcaaaacgttctattgaggaccactttgattcaaactttgagcttgaatacaatcttaag
gaaaaaggcaaaacggatttgttaaaattggtagatgaagcaactggcatgcgccttcat
ttcatccgccaaactcaccctcgtggtcttggagacgctgtcttacaagccaaagctttt
gtaggaaatgaacccttcgttgttatgctgggtgatgacttgatggacatcacagacgag
aaggccgttcctttgacaaaacaactgatgaatgattacgaaaagacacacgcatcaacc
attgctgtcatgcccgtaccacacgaagacgtttcatcatatggagtcattgctcctcaa
gacgaaggaaaagatggtctttacagtgttgaaacctttgttgaaaaaccagctcccgag
gagactccaagtgatttggcaatcatcggtcgctatctactcacaccagaaatttttgag
attctcgaaaagcaagctcctggtgctggaaatgaaatccaacttactgatgcaatcgat
actcttaataaaacacagcgtgtttttgcccgtaaatttacaggagctcgttacgacgtt
ggggataagtttggctttatgaaaacatctattgactacgccctcaaacatccacaagtc
aaagatgatttgaagaattacctcatccaacttggaaaagaattgactgagaaggaataa

DBGET integrated database retrieval system