KEGG   Streptococcus pneumoniae AP200: SPAP_2207Help
Entry
SPAP_2207         CDS       T01309                                 

Definition
(GenBank) L-fucose isomerase-like protein
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
snp00051  Fructose and mannose metabolism
snp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPAP_2207
Enzymes [BR:snp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     SPAP_2207
    5.3.1.25  L-fucose isomerase
     SPAP_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N2 Fucose_iso_N1 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: ADM85738
Structure
PDB: 

Jmol
Position
complement(2047868..2049634)
Genome map
AA seq 588 aa AA seqDB search
MIQHPRIGIRPTIDGRRQGVRESLEVQTMNMAKSVADLISSTLKYPDGEPVECVISPSTI
GRVPEAAASHELFKKSNVCATITVTPCWCYGSETMDMSPDIPHAIWGFNGTERPGAVYLA
AVLASHAQKGIPAFGIYGRDVQEANDTDIPEDVKEKLLRYARAALATGLMRDTAYLSMGS
VSMGIGGSIVNPDFFQEYLGMRNESVDMTEFTRRMDRGIYDPEEFERAMVWVKEHIKEGV
DRNREDLILSKEEKEKQWEFVIKMFMIGRDLMVGNPRLAELGFEEEAVGHHALVAGFQGQ
RQWTDHFPNGDFMETFLNTQFDWNGIRKPFVFATENDSLNGVSMLFNYLLTNTPQIFADV
RTYWSPEAVKRVTGHTLEGRAAAGFLHLINSGSCTLDGTGQATRDGKPVMKPFWELEESE
VQAMLENTDFPPANREYFRGGGFSTRFLTKGDMPVTMVRLNLLKGVGPVLQIAEGYTLEL
PEDVHHTLDNRTDPGWPTTWFAPRLTGKGAFKSVYDVMNNWGANHGAITYGHIGADLITL
ASMLRIPVNMHNVPEEDIFRPKNWSLFGTEDLESADYRACQLLGPLHK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacatccacgtattgggattcgtccgactattgatggtcgtcgtcaaggtgta
cgcgaatcacttgaagtacaaacaatgaacatggctaaaagtgtggcagatttgatttca
agcacattgaaatatccagatggggaacctgtggaatgtgtgatttctccatctaccatt
ggtcgtgttccagaggctgcagcttcccatgagttgtttaaaaaatcaaatgtttgcgca
acaattacagttacaccatgctggtgttatggtagtgaaactatggatatgtctccagat
attcctcatgctatttggggatttaatgggacagaacgcccaggagctgtctatcttgca
gctgtactagcttcacatgctcaaaaagggattccagcctttgggatttatggtagagat
gttcaggaagctaatgatacagatattccagaagatgtcaaagaaaaacttttacgttat
gcgcgtgcagctcttgcaactggcttgatgagagacactgcttacctatcaatgggtagt
gtttcgatggggattggcggttctattgtaaatccagatttcttccaagaatacttagga
atgcgaaatgaatcggtagatatgacggagttcacgcgccgtatggaccgtggtatttat
gacccagaagagttcgaacgtgctatggtttgggtaaaagaacatatcaaagaaggggtt
gaccgaaatcgtgaggatttgattctttctaaagaagagaaagaaaaacaatgggaattt
gttattaagatgttcatgattggacgtgacttaatggttggtaacccaagacttgctgaa
cttggttttgaggaagaagcggttggtcaccatgctttagtagctggtttccaaggtcaa
cgtcagtggacagaccattttccaaatggagattttatggaaactttcctcaatactcag
tttgactggaatggtattcgaaaaccatttgtatttgcgacagagaatgattcactaaat
ggtgtgtctatgctctttaattatctattaacaaatactccacaaatctttgctgatgtg
cgtacttattggagcccagaggctgttaaacgtgtaacgggacatactttagagggtcgt
gctgcagctggcttcttacatctaatcaactctggttcttgtacattggatggtacaggt
caagctactcgagatggcaaacctgttatgaaaccattctgggagttggaagaaagtgaa
gtgcaggctatgcttgaaaatacagacttcccaccagcaaaccgcgaatacttccgtgga
ggaggattctcaactcgtttcttgacgaagggggatatgccagtaacaatggtacgtctc
aatcttctaaaaggggttggtccagtgctacaaattgcagaaggttatacacttgaactt
cctgaagatgttcaccatactttagataatcgtacagatccaggatggccaactacttgg
tttgctccacgtttgacaggaaaaggtgctttcaagtctgtctatgacgtcatgaataat
tggggagctaatcacggagccataacatatggacacattggagcagacttgattaccttg
gcttctatgttgagaattcctgtcaatatgcataatgtacctgaggaagatatctttaga
cctaaaaattggtccttatttggaacagaagatctagaatcagcagactatcgtgcatgt
cagttgttgggaccactacataaataa

DBGET integrated database retrieval system