KEGG   Streptococcus pneumoniae AP200: SPAP_2215Help
Entry
SPAP_2215         CDS       T01309                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase and aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPAP_2215
Enzymes [BR:snp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SPAP_2215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2058102..2058740)
Genome map
AA seq 212 aa AA seqDB search
MSDVKQELIKYGKKLVETDLTKGTGGNLSVFDREKQLMAITPSGIDFFEIKESDIVVMDI
NGNVVEGERLPSSEWYMHLIQYQTRDDIDAIIHAHTTYATVLACLREPLPASHYMIAVAG
KDVRVAEYATYGTKELAVNAAKAMEGRRAVLLANHGILAGSQNLLNAFNIVEEVEYCAKI
YCLAKNFGEPVVLPDEEMELMAEKFKTYGQRK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaaaacaagaattaattaagtatggcaagaagctagtagaaacagatttg
acgaaaggaacaggtgggaatctcagtgttttcgatcgtgaaaaacaattgatggcaatt
accccgtcgggtattgatttctttgaaatcaaagaatccgatattgtagtgatggatatt
aatggaaatgttgtagagggagaacgcttgccatctagcgaatggtatatgcatttgatt
caatatcaaactcgtgatgatatcgatgcaattatccatgctcatacaacttatgcaaca
gtattagcttgtctcagagaaccacttccagcgagtcattatatgattgcagtggcaggg
aaagatgttcgggtagctgagtatgcaacatatggcacgaaagaattggctgtgaatgca
gctaaagcaatggaaggtcgtagagcagttttactagcgaatcatggaattttagcaggt
tcacaaaatttattgaatgcatttaatattgttgaagaagttgaatattgtgcaaaaatt
tattgtttagctaagaattttggagagccagtagttcttcctgatgaggagatggaattg
atggcagaaaaatttaaaacatacggtcagagaaaatag

DBGET integrated database retrieval system