KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0097Help
Entry
SPT_0097          CDS       T00875                                 

Definition
beta-galactosidase (Lactase) (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPT_0097
Enzymes [BR:snt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPT_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84329..86116
Genome map
AA seq 595 aa AA seqDB search
MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALGFNTVETYVAWNLHEP
REGEFHFEGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGLPAWLLTKNMRIRSSDP
AYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGEDKAYLRAIRQLMEECGVT
CPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQEFFDEHGKKWPLMCMEFW
DGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGTNFGFMNGCSARGTLDLPQV
TSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLYKESMELDAIPLVEKVSLFET
LDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEERLRIIDGRDRAQLYVDGQWVK
TQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHKFLADTQRKGIRTGVCKDLHFLL
NWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEEPKDTYLDLSEFGKGVAFVNGQNL
GRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYKEEIHLTRKPTLKHIKGENL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacacgatttgagatacgagatgatttctatctcgatggaaaatcatttaagatttta
tctggtgccattcattattttagggttcctccagaggattggtatcattcgctctataac
ttgaaggctcttggttttaatacggtagagacttatgttgcttggaatttacacgagcct
cgtgaaggtgagtttcattttgaaggtgatctggatttagagaaatttctccaaatagcg
caggatttgggtctctacgcaattgtgcgtccgtctccatttatctgtgcggaatgggaa
ttcggtggcttaccagcttggctcttgaccaagaacatgcgaattcgctcatccgaccca
gcatatatcgaggcagttggtcgctactatgatcagttattgccaagactggtgcctcgt
ttgttggacaatggtggcaatattctcatgatgcaggttgaaaatgagtatggttcttac
ggagaagataaggcttatctgagagcgattcgacagctaatggaagagtgtggcgtaacc
tgtcccctctttacatcagatggtccatggcgagctactctgaaagctggaaccttaatt
gaagaggacctctttgtaacaggaaactttggttctaaggcaccttacaatttttcgcag
atgcaggaattctttgatgaacatggtaagaaatggccactcatgtgtatggagttctgg
gatggttggtttaatcgttggaaagaaccgattatcacacgggatcctaaggaattggca
gatgcagttcgagaagttttggaacaaggctccatcaatctttacatgttccacggtggt
acaaactttggtttcatgaatggttgctcggctcgaggaactttggacctgccacaagtt
acgtcttatgattacgatgcccttctggatgaagaaggaaatccaactgctaaatatctt
gcagtcaagaagatgatggcaacacatttttcagagtatccgcagttggaaccactctac
aaagagagtatggagttggatgctattccactagttgaaaaagtttctttgtttgaaacc
ttagatagcttgtcaagtcctgtagaaagtctctatcctcaaaagatggaggagctggga
caaagttatggctacctactttatcgaacagaaacaaactgggatgcagaagaagaaaga
cttcgtatcattgatggtcgagatagggcccagctgtatgtcgatggtcagtgggttaaa
actcaatatcagacagagattggggaagatattttttatcaaggtaaaaagaaagggcta
tctaggttagatatcttgatagaaaatatggggcgtgtcaactatgggcataagttctta
gcggatacgcaacgtaagggaattcggacaggggtctgtaaggatctgcatttcttacta
aactggaaacactatccactcccactagacaatcctgagaaaattgatttttcaaaagga
tggactcaaggacaaccagccttttacgcttatgactttacagtcgaagagccaaaagat
acttacctagacttgtctgagtttggtaagggggttgcctttgtcaatgggcagaatcta
ggacgtttttggaacgttggcccaactctctcactttatatccctcatagctatctcaag
gaaggtgccaaccgcatcattatctttgaaacagaaggtcaatataaagaagagattcat
ttaactcgtaaacctacactaaaacatataaagggggaaaacttatga

DBGET integrated database retrieval system