KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0197Help
Entry
SPT_0197          CDS       T00875                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPT_0197
  Amino acid metabolism
   00300 Lysine biosynthesis
    SPT_0197
Enzymes [BR:snt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SPT_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
173569..174942
Genome map
AA seq 457 aa AA seqDB search
MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEV
EIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRG
VDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTDLDKYLEKHADKLRGADL
LVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYGGVVESAPWYLLQALQSLR
AADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIYGLELPLLQEERMAFLKRFF
FDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLEPHDVLEKIRKQLDKNGFDKV
ELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLPTTAGTGPMHTVFDALEVPMVA
FGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcctagcgaacaagaacagattgaaaaatttgaaaaggatcatgtagcccag
cattattttgaggttttgcgtaccttgatttctaagaaatcagtctttgcccagcaggtt
ggactcaaggaagtcgcaaattatctgggtgagattttcaagcgtgttggagctgaagtg
gagattgatgagagctatacagcgccctttgtcatggcacatttcaagagttcgcgtcca
gatgccaagaccttgattttctataaccactatgacactgtgccagcggatggggatcag
gtctggacagaggatccttttacgctttcggtccgcaatggcttcatgtatgggcgtggg
gttgatgacgacaagggtcatatcacagctcgcttgagtgctttgagaaaatatatgcag
caccatgatgatttacctgtcaatatcagctttatcatggagggagcggaggaatcggct
tcaacagacctagataagtatttggaaaagcatgcagacaaactccgtggggcggatttg
ttggtctgggaacaagggaccaaaaatgccttggaacagctggaaatttctggtggcaat
aaggggattgtgacctttgatgccaaggtaaaaagcgctgatgtggatatccactcgagt
tatggtggtgttgtggaatcagctccttggtatctcctccaagccttacagtctcttcgt
gctgcggatggccgtatcttggttgaaggcttgtacgaagaagtacaagagcccaatgaa
cgagaaatggccttgctagaaacttatggtcaacgaaacccagaggaagttagtcggatt
tatggattggagttgcctctcttacaggaggagcggatggcctttctaaaacgtttcttt
ttcgatccagcgcttaatatcgaaggaatccagtctggttatcaaggtcagggtgttaag
actattttacctgcagaagccagtgccaagctagaggttcgtctggttccgggcctagaa
ccgcatgatgttctggaaaaaattcggaaacagctagacaaaaatggctttgataaggta
gaattatactataccttgggagagatgagctatcgaagcgatatgagcgcaccagccatt
ctcaatgtgatcgagttggccaagaaattctatccacagggcgtttcagtcttgccgacg
acagcggggacaggacctatgcatacggtctttgatgccctagaggtaccaatggttgca
ttcggtctaggaaatgccaatagccgagaccacggtggagatgaaaatgtgcgaatcgct
gattattacacccatatcgaattagtagaggagctgattagaagctatgagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system