KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0216Help
Entry
SPT_0216          CDS       T00875                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:snt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
193033..193626
Genome map
AA seq 197 aa AA seqDB search
MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEDQIYVHQVVREDAHLLY
GFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETKNITYLTKFPKIGKKTA
QQMVLDLEGKVVVAGDDLPAKIAVQASAENQELEEAMEAMLALGYKATELKKIKKFFEGT
TDTAENYIKSALKMLVK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatatttaaaaggaatcattaccaaaattactgccaaatacattgttcttgaa
accaatggtattggttatatcctgcatgtggccaatccttatgcctattcaggtcaggtt
aatcaggaggatcagatttatgtgcatcaggttgtgcgtgaggacgcccatttgctttat
ggatttcgctcagaggatgagaaaaagctctttcttagtctgatttcggtctctgggatt
ggtcctgtatcagctcttgctattatcgctgctgatgacaatgctggcttggttcaagcc
attgaaaccaagaacatcacctacttgaccaagttccctaaaattggcaagaaaacagcc
cagcagatggtgctggacttggaaggcaaggtagtagttgcaggagatgaccttcctgcc
aagatcgcagtgcaagcaagtgctgaaaaccaagaattggaagaagctatggaagccatg
ttggctctgggctacaaggcaacagagctcaagaaaatcaagaaattctttgaaggaacg
acagatacagctgagaactatatcaagtcggcccttaaaatgttggtcaaatag

DBGET integrated database retrieval system