KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0335Help
Entry
SPT_0335          CDS       T00875                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:snt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300601..301578
Genome map
AA seq 325 aa AA seqDB search
MVKSLEGVTDMLSKANRAKTAICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASML
DIGGESTRPGSSYYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGANLV
NDITGLMGDEKMAHVIAKDGAKVVIMFNPVMARPQHPSSLIFPHFGFNQAFTEEELADFE
TLPIEELMETFFERALARANQAGIAQENILLDPGIGFGLTKKENLLLLRDLDKLHQKGYP
IFLGVSRKRFVINILEENGFEVNPETELGFHNRDTASAHVTSIAARQGVEVVRVHDVASH
RMAVEIASAIRLADEAENLDLKQYK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaagccttgagggagtgaccgatatgttaagtaaagccaatcgtgcaaagaca
gctatttgcggaattatcaatgtaaccccagactccttttcggacggtggtcaatttttt
gctcttgagcaggcactccagcaggctcgtaaattgatagcagaaggggctagcatgcta
gatatcggtggagaatcaactcggccgggaagtagctattatgttgagatagaagaggag
atccagcgtgttgttccagtgattaaagcgattcgcaaggaaagtgatgtcctcatttct
attgatacttggaaaagtcaggttgcagaggctgctttggctgctggtgccaatctagtc
aatgatatcactggtctcatgggtgatgaaaaaatggcccatgtgatagctaaagatgga
gcgaaagtggtcattatgtttaatcctgttatggctcgacctcagcatcctagctcgctc
atattccctcattttggatttaatcaagcttttacagaggaagagttagctgactttgaa
acattgccaatcgaagagttgatggagactttctttgaaagagcactagcgagagcaaat
caagctggaattgcacaagaaaatatcctgttggatccaggaatcggctttgggctgact
aagaaagaaaatttgcttcttttacgagacctggataaactacatcagaagggctatcca
atctttcttggagtgtcgcgcaagaggtttgtcatcaatatccttgaagaaaatggtttt
gaagtcaatcctgagacagaacttggtttccacaatcgggacacagcttcggctcatgta
accagtatcgctgcgagacagggtgtggaagtggtgcgcgtgcatgacgtagctagtcac
aggatggcagttgaaattgcctccgccattcgtctggctgatgaagcggaaaatctagat
ttaaaacaatataaataa

DBGET integrated database retrieval system