KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0335Help
Entry
SPT_0335          CDS       T00875                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPT_0335 (folP)
Enzymes [BR:snt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SPT_0335 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300601..301578
Genome map
AA seq 325 aa AA seqDB search
MVKSLEGVTDMLSKANRAKTAICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASML
DIGGESTRPGSSYYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGANLV
NDITGLMGDEKMAHVIAKDGAKVVIMFNPVMARPQHPSSLIFPHFGFNQAFTEEELADFE
TLPIEELMETFFERALARANQAGIAQENILLDPGIGFGLTKKENLLLLRDLDKLHQKGYP
IFLGVSRKRFVINILEENGFEVNPETELGFHNRDTASAHVTSIAARQGVEVVRVHDVASH
RMAVEIASAIRLADEAENLDLKQYK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaagccttgagggagtgaccgatatgttaagtaaagccaatcgtgcaaagaca
gctatttgcggaattatcaatgtaaccccagactccttttcggacggtggtcaatttttt
gctcttgagcaggcactccagcaggctcgtaaattgatagcagaaggggctagcatgcta
gatatcggtggagaatcaactcggccgggaagtagctattatgttgagatagaagaggag
atccagcgtgttgttccagtgattaaagcgattcgcaaggaaagtgatgtcctcatttct
attgatacttggaaaagtcaggttgcagaggctgctttggctgctggtgccaatctagtc
aatgatatcactggtctcatgggtgatgaaaaaatggcccatgtgatagctaaagatgga
gcgaaagtggtcattatgtttaatcctgttatggctcgacctcagcatcctagctcgctc
atattccctcattttggatttaatcaagcttttacagaggaagagttagctgactttgaa
acattgccaatcgaagagttgatggagactttctttgaaagagcactagcgagagcaaat
caagctggaattgcacaagaaaatatcctgttggatccaggaatcggctttgggctgact
aagaaagaaaatttgcttcttttacgagacctggataaactacatcagaagggctatcca
atctttcttggagtgtcgcgcaagaggtttgtcatcaatatccttgaagaaaatggtttt
gaagtcaatcctgagacagaacttggtttccacaatcgggacacagcttcggctcatgta
accagtatcgctgcgagacagggtgtggaagtggtgcgcgtgcatgacgtagctagtcac
aggatggcagttgaaattgcctccgccattcgtctggctgatgaagcggaaaatctagat
ttaaaacaatataaataa

DBGET integrated database retrieval system