KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0354Help
Entry
SPT_0354          CDS       T00875                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPT_0354 (celA)
Enzymes [BR:snt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPT_0354 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316200..317636
Genome map
AA seq 478 aa AA seqDB search
MTTFKDGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAREITSGVLEGKYYPNH
EAIDFYHRYKEDIALFAEMGFKCFRTSLAWTRIFPKGDELEPNEEGLQFYDNLFDECLKN
GIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFARFAEVVFKRYKDKVKYWMTFNEINNQ
ANYQEDFAPFTNSGIVYEEGDNREAIMYQAAHYELVASARAVKIGHEINPDFQIGCMIAM
CPIYPATCNPKDILMAMKAMQKRYYFADVHVLGKYPEHIFKYWERKGISVDFTAQDKEDL
LGGTVDYIGFSYYMSFAIDFHRENNPYFDYLETEDLVKNNYVKASEWEWQIDPEGLRYAL
NWFTDHYHLPLFIVENGFGAIDQVAADGMIHDDYRIEYLGAHIREMKKAVVEDGVDLMGY
TPWGCIDLVSAGTGEMRKRYGFIYVDKDDNGKGSYNRSPKKSFGWYKEVISSNGESVE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgactacttttaaagatggatttttatggggtggtgctgttgctgctcatcaacttgaa
ggtggatggcaagaaggtggcaagggaattagtgttgctgatgttatgactgctggtcgt
catggagtagctcgtgaaattacttcgggagttttagagggtaaatattatccaaatcat
gaggcgatagatttttatcatcgttataaagaagacatagcactttttgctgaaatggga
ttcaagtgcttccgtacctctcttgcatggacacgtatctttccaaaaggtgatgagtta
gagccgaatgaagaaggattacagttttatgataatctttttgatgaatgcttaaagaat
ggtattgaacctgtcatcactctatctcattttgaaatgccttatcacttagtgaccgaa
tatggtggttggaaaaataggaaattgattgatttctttgctcgttttgcagaagtcgta
tttaaacgttacaaagataaggttaaatattggatgactttcaatgaaatcaataatcaa
gcgaattatcaggaagattttgcaccatttactaactcaggtattgtatatgaggaaggt
gataatagagaagcaattatgtatcaagcagcacattacgaattagttgcttctgcacga
gctgtaaaaattggtcatgagattaatccagattttcaaataggttgtatgattgcgatg
tgtccaatttatccagctacttgcaatcctaaggatatcttaatggcaatgaaagctatg
cagaagcgttattattttgctgatgtgcatgttttaggtaaatatcctgagcatattttc
aagtattgggaacgaaaaggtatttcagttgattttactgcccaggataaagaagattta
cttggtgggactgtagattacattggtttcagttactatatgtcctttgctatcgacttt
catcgtgaaaataatccttattttgattatcttgaaacagaagatttagtgaaaaataat
tatgttaaggcttctgaatgggagtggcaaattgatccagaaggtttacgttatgcgtta
aattggtttacagaccactatcacttaccactctttattgttgaaaatggttttggagct
atagatcaagttgcagcagatggtatgatacatgatgattatagaattgaatatctaggt
gcccatattcgtgaaatgaaaaaggctgtagttgaagatggtgttgatttaatgggttat
actccatggggatgtattgatttggtttcagctggtaccggtgaaatgcggaaacgttat
ggctttatttatgtagataaagatgataatgggaagggaagttataatcgttccccgaaa
aaatcttttggctggtataaggaagttatttcatctaacggtgaatcagtagaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system