KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0363Help
Entry
SPT_0363          CDS       T00875                                 

Definition
peroxiredoxin Hyr1 (hydrogen peroxide resistanceprotein 1) (oxidant receptor peroxidase 1) (glutathione peroxidase 3)(phospholipid hydroperoxide glutathione peroxidase 3) (phgpx3) (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:snt00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:snt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(326148..326624)
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTTTGCGLMPQYQGLQELYERYQDQGFEIL
DFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEADPLYVWLKDHKSGPLGK
RIEWNFAKFLISRDGQVFERFSSKTDPKQIEEAIQTLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactttatgatttttccgttttgaaccaaaacaaccaagcaactcccttggat
agctatcgtggcaaagttctcttgattgtcaacactactactggatgtggtttaatgccc
cagtaccagggacttcaagaactctatgaacgctatcaagatcagggcttcgaaatattg
gatttcccttgcaatcagtttatgggacaagcacccggcagcgcagaggaaatcaacgcc
ttctgtagcctacattttcaaaccaccttcccacgttttgccaagattaaggtcaacggt
aaggaagcagaccctctctatgtctggttaaaagaccataaatctggcccactaggaaaa
cgaatcgaatggaatttcgctaagtttctcattagtcgtgatgggcaagtctttgaacgc
ttttcttcaaaaacagacccaaaacaaattgaagaggcgatacaaactctactataa

DBGET integrated database retrieval system