KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0464Help
Entry
SPT_0464          CDS       T00875                                 

Gene name
accA
Definition
acetyl-CoA carboxylase subunit alpha (EC:6.4.1.2)
Orthology
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPT_0464 (accA)
   01212 Fatty acid metabolism
    SPT_0464 (accA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPT_0464 (accA)
   00640 Propanoate metabolism
    SPT_0464 (accA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SPT_0464 (accA)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    SPT_0464 (accA)
Enzymes [BR:snt01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SPT_0464 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
429287..430054
Genome map
AA seq 255 aa AA seqDB search
MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVVGGIGWLGDQAVTVVG
IQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFINTAGAYPGVGAEERGQ
GEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWMLENSIYAILSPEGFASIL
WKDGTRAMEAAELMKITSHELLEMDVVDKVISEVGLSSKELIKSVKKELQTELARLSQKP
LEELLEERYQRFRKY
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcaaaaatagtcagagaagcgcgtgagcagagtcgcttgacaaccttggac
tttgctacaggcatttttgatgaatttatccaattacatggtgaccgttcttttcgtgat
gatggtgcagttgttggtggtattggttggcttggagaccaagctgtaacagtggttggt
atccaaaaaggcaagagtttgcaagacaacctcaaacggaattttggccaaccacatcca
gaaggctaccgaaaggcactgcggttgatgaaacaggctgagaaatttggccgtccagtt
gtgacctttatcaatacagcaggtgcttatcctggtgtcggagcggaagaacgtggtcaa
ggggaagctatcgctcgcaatctcatggaaatgagtgacctgaaagttcctattatcgcc
attattatcggtgaaggtggttcaggcggggctctggctctagctgtcgcggaccgtgtc
tggatgctggaaaattctatctatgccattctcagtccagaaggctttgcttccatttta
tggaaggacggtactcgcgccatggaagcagcagaactgatgaaaatcacttcgcatgaa
ctgttagaaatggacgtggtggataaggtgatttctgaagtaggactttctagtaaagaa
ctgattaagagtgtcaaaaaagaactccaaacggagctggctagactttcacaaaaaccg
ctagaagagttgctggaagaacgctatcaacgatttagaaaatactaa

DBGET integrated database retrieval system