KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0608Help
Entry
SPT_0608          CDS       T00875                                 

Definition
beta-glucosidase (Gentiobiase) (Cellobiase) (Beta-D-glucoside glucohydrolase) (Amygdalase) (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPT_0608
Enzymes [BR:snt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPT_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
566546..567961
Genome map
AA seq 471 aa AA seqDB search
MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEATENPTEDNLKLLGIDF
YHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKYYDELFDELHAHGIEPL
VTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKVKYWLTFNEVNSVLELPF
TSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEFKVGCMVLAMPAYPMTPNP
KDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKEHDINIEFAAEDAELLKNYTVDFLSF
SYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQIDPIGLRIILNRYYDRYQIPL
FIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMEEHLLQVAEALQDGVEIMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWYKGVIESNGESLFK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttttccagatgattttctttggggtggagcggttgcagctaatcaagtagag
ggagcatataatgaagatggtaagggattatcagttcaggatgtgttacccaaaggtgga
ttaggagaagcaacagaaaatcctacagaagataacttaaaattgttaggtattgatttt
tatcataaatataaggaagatatatccttgttttctgaaatgggctttaatgtttttcgt
acttctattgcatggagtagaatttttccaaaaggagatgaagaagaacctaacgaagct
gggttgaaatattatgatgaattatttgatgaactacatgctcacgggatagaaccactt
gtaactctttcacactatgagactccattatatttagcaagaaaatatcatggatggatt
gataggagaatgattcatttttatgaaaaatttgctcgaacagttttagaaaggtataaa
gataaagttaaatattggcttacatttaacgaagtaaactctgttttggaattaccgttt
actagtggaggaatagatatacctaaggagaatctttcgaaacaagaattatatcaagct
atacatcatgaattagtcgcctcgagtttggttacaaaaattgctcgtgagattaattca
gagtttaaggtggggtgtatggtattagctatgccagcttatccaatgactccaaatcca
aaagatgtatgggcgactcatgagtatgagaatctaaattatctattttcagatgtgcat
gttagaggttattatccgaattatgcaaaaagatattttaaggaacatgacattaacata
gagtttgcagctgaagatgcagagttattaaaaaattatactgtagattttttatccttt
agctattacatgagtgtgactcaatctgctcttccaacacagtataattcaggagaaggg
aatattattggtggcttagtaaatccttatttagagtcttctgagtggggatggcaaatt
gatccaattggactacgtataattttaaatagatattatgaccgttatcaaattccatta
tttatagtggaaaacggattaggtgctaaagatcaactaataaaagatgaatttaataac
ttaacagtccaagatgattatagaattcagtatatggaagaacatttattgcaagtagct
gaagctctacaagatggtgtggaaattatgggctatacatcttggggatgtattgactgc
gtttctatgtccactgcacaactttctaaaaggtacggtctcatttatgttgatcgaaat
gatgatggaaatggcacattcaatcgatataagaaaatgtcctttacttggtataaagga
gtgattgaatcaaatggagaatccttattcaaatag

DBGET integrated database retrieval system