KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0631Help
Entry
SPT_0631          CDS       T00875                                 

Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:snt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:snt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:snt00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:snt00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:snt00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:snt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592372..593253
Genome map
AA seq 293 aa AA seqDB search
MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPVLIQTSMGAAKYMGGY
KVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIMFDGSHLPVEENLKLAK
EVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMVETGIDFLAAGIGNIHGP
YPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAIKLGVAKVNVNTECQIAFA
NATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVEERIDVFGSEGKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtttcagcagaaaaatttgtccaagcagcccgtgacaacggttatgcagtt
ggtggatttaacacaaacaaccttgagtggactcaagctatcttgcgcgcagcagaagct
aaaaaagctccagttttgatccaaacttcaatgggtgctgctaaatacatgggtggttac
aaagttgctcgcaacttgatcgctaaccttgttgaatcaatgggtatcactgtaccagta
gctatccaccttgaccacggtcactacgaagatgcacttgagtgtatcgaagttggttat
acttcaatcatgtttgacggttcacaccttccagttgaagaaaaccttaaattggctaaa
gaagttgttgaaaaagcacacgctaaaggtatctcagtagaagctgaagttggtactatc
ggtggtgaagaagacggaatcatcggtaaaggtgaattggctccaatcgaagacgctaaa
gcaatggttgaaactggtatcgacttcttggcagctggtatcggtaacatccacggccct
tacccagtaaactgggaaggtcttgaccttgaccacttgcaaaaattgacagaagctctt
ccaggattcccaatcgtattgcacggtggatcaggtattcctgatgagcaaatccaagca
gctatcaaacttggtgttgccaaagttaacgttaacacagaatgccaaatcgcattcgct
aacgcaactcgtaaatttgctcgtgattacgaagcaaacgaagcagaatacgacaagaaa
aaactcttcgacccacgtaaattcttggctgacggtgtaaaagctatccaagcatcggtt
gaagaacgtatcgacgtattcggttcagaaggtaaagcataa

DBGET integrated database retrieval system