KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0631Help
Entry
SPT_0631          CDS       T00875                                 

Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPT_0631
   01230 Biosynthesis of amino acids
    SPT_0631
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPT_0631
   00030 Pentose phosphate pathway
    SPT_0631
   00051 Fructose and mannose metabolism
    SPT_0631
  Energy metabolism
   00680 Methane metabolism
    SPT_0631
Enzymes [BR:snt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SPT_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592372..593253
Genome map
AA seq 293 aa AA seqDB search
MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPVLIQTSMGAAKYMGGY
KVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIMFDGSHLPVEENLKLAK
EVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMVETGIDFLAAGIGNIHGP
YPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAIKLGVAKVNVNTECQIAFA
NATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVEERIDVFGSEGKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtttcagcagaaaaatttgtccaagcagcccgtgacaacggttatgcagtt
ggtggatttaacacaaacaaccttgagtggactcaagctatcttgcgcgcagcagaagct
aaaaaagctccagttttgatccaaacttcaatgggtgctgctaaatacatgggtggttac
aaagttgctcgcaacttgatcgctaaccttgttgaatcaatgggtatcactgtaccagta
gctatccaccttgaccacggtcactacgaagatgcacttgagtgtatcgaagttggttat
acttcaatcatgtttgacggttcacaccttccagttgaagaaaaccttaaattggctaaa
gaagttgttgaaaaagcacacgctaaaggtatctcagtagaagctgaagttggtactatc
ggtggtgaagaagacggaatcatcggtaaaggtgaattggctccaatcgaagacgctaaa
gcaatggttgaaactggtatcgacttcttggcagctggtatcggtaacatccacggccct
tacccagtaaactgggaaggtcttgaccttgaccacttgcaaaaattgacagaagctctt
ccaggattcccaatcgtattgcacggtggatcaggtattcctgatgagcaaatccaagca
gctatcaaacttggtgttgccaaagttaacgttaacacagaatgccaaatcgcattcgct
aacgcaactcgtaaatttgctcgtgattacgaagcaaacgaagcagaatacgacaagaaa
aaactcttcgacccacgtaaattcttggctgacggtgtaaaagctatccaagcatcggtt
gaagaacgtatcgacgtattcggttcagaaggtaaagcataa

DBGET integrated database retrieval system