KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_0692Help
Entry
SPT_0692          CDS       T00875                                 

Definition
glucokinase (Glucose kinase) (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPT_0692
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPT_0692
   00052 Galactose metabolism
    SPT_0692
   00500 Starch and sucrose metabolism
    SPT_0692
   00520 Amino sugar and nucleotide sugar metabolism
    SPT_0692
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPT_0692
   00524 Butirosin and neomycin biosynthesis
    SPT_0692
Enzymes [BR:snt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPT_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663148..664107
Genome map
AA seq 319 aa AA seqDB search
MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLGL
AAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAAL
GERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPIACTCG
KKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagattattgggattgaccttggcggaacttctatcaaatttgcaatctta
acaacagcaggagaaatccaaggaaaatggtcaatcaagaccaacattttggatgaggga
agtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttggattg
gcagcagcggacttccaaggcattggaatgggatcaccaggtgtggttgaccgtgacaaa
gggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaaaag
attgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagctctt
ggtgagcgctggatgggtgctggtgataaccaaccagatgttgtctttatgacactcggt
actggtgttggtggtggtattgtcgcagaaggcaaattgcttcatggtgttgctggtgca
gcaggtgaacttggtcatatcactgttgattttgaccaaccaattgcatgtacttgtggt
aaaaaaggctgtcttgagacagtcgcttctgcaacaggaattgtcaatttgactcgtcgc
tatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataacggagaagaa
gtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgattgtt
taccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatcctaaac
ccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaaggt
gttcaaaaagtttacgatgaaaatagtttcccacaagtacgcacatctactaaattagct
cttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaataa

DBGET integrated database retrieval system