KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_1325Help
Entry
SPT_1325          CDS       T00875                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:snt00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1266230..1267141)
Genome map
AA seq 303 aa AA seqDB search
MIYTVTLNPSIDYIVRLDQVKVGSVNRMDSDDKFAGGKGINVSRVLKRLNIPNTATGFIG
GFTGKFITDTLAEEEIETRFVQVAEDTRINVKIKADQETEINGTGPTVESVQLEELKAIL
SSLTAEDTVVFAGSSAKNLGNVIYKDLISLTRQTGAQVVCDFEGQTLIDSLDYQPLLVKP
NNHELGAIFGVKLESLDEIEKYARELLAKGAQNVIISMAGDGALLVTSEGAYFAKPIKGT
VKNSVGAGDSMVAGFTGEFVKSKDAVEAFKWGVACGTATTFSDDLATAEFIKETYGKVEV
EKR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtcacactcaatccatccattgactatatcgttcgtttggaccaagtc
aaagttggtagtgtcaatcgtatggacagtgatgataagtttgctggtgggaaaggaatc
aatgtcagccgtgtcttgaaacgtttgaatataccaaatacagcgacgggatttatcggt
ggctttactggtaaatttatcacagatactttagcagaggaagaaatcgagacacgtttt
gtccaggtggcagaagatactcgtatcaatgttaaaatcaaagcagaccaagaaacagaa
atcaacggaacgggtccaactgttgaatcggttcagctagaagaattgaaagctatttta
tctagtctgacagcagaagatacagttgtctttgcaggttcaagtgctaaaaatctaggc
aatgttatctataaggatttgatttccttgacgcgccagactggtgcgcaagtggtctgt
gactttgaaggacagaccttaattgatagtttggactaccagcctcttcttgtaaaacca
aacaatcatgaacttggagcgatttttggggttaaactcgaaagtttagatgaaattgag
aaatacgctcgtgagttactggctaagggtgctcaaaatgttattatctctatggctggt
gatggtgcccttcttgtcacatctgagggagcttacttcgctaaaccaatcaaaggaaca
gtcaaaaattcagttggagctggtgattctatggttgctggattcacaggtgaatttgtc
aaatcaaaagacgcagtagaagccttcaaatggggagtggcttgcggaacggcaactacc
ttctcagatgacttggcaacggcggaatttattaaagaaacatatggaaaagttgaggta
gaaaaacgatga

DBGET integrated database retrieval system