KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_1514Help
Entry
SPT_1514          CDS       T00875                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
snt00010  Glycolysis / Gluconeogenesis
snt00051  Fructose and mannose metabolism
snt00562  Inositol phosphate metabolism
snt01100  Metabolic pathways
snt01110  Biosynthesis of secondary metabolites
snt01120  Microbial metabolism in diverse environments
snt01130  Biosynthesis of antibiotics
snt01200  Carbon metabolism
snt01230  Biosynthesis of amino acids
Module
snt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPT_1514 (tpiA)
   00051 Fructose and mannose metabolism
    SPT_1514 (tpiA)
   00562 Inositol phosphate metabolism
    SPT_1514 (tpiA)
Enzymes [BR:snt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPT_1514 (tpiA)
Exosome [BR:snt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPT_1514 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPT_1514 (tpiA)
  Exosomal proteins of melanoma cells
   SPT_1514 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACO24038
Structure
PDB: 

Jmol
Position
complement(1444473..1445231)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTAVLAAAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcatttgttgaagcagttgcatcaaaacttccttcatcagaccttgttgaagcaggt
atcgctgctccagctcttgatttgacagctgttcttgctgctgctaaaggttcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaacaagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgacgaagatatcaacaaaaaagcaaaagcaatctttgcaaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttatgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcatcagttatcgcttacgagccaatctgggctatcggtactggtaaatcagcttca
caagacgacgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagttgcagacaaggttcgtgttcaatacggtggttctgttaaacctgagaacgtt
gcttcatacatggcttgtccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system