KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_1772Help
Entry
SPT_1772          CDS       T00875                                 

Definition
alcohol dehydrogenase, zinc-containing
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPT_1772
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPT_1772
  Lipid metabolism
   00071 Fatty acid degradation
    SPT_1772
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPT_1772
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPT_1772
   00626 Naphthalene degradation
    SPT_1772
Enzymes [BR:snt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPT_1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1686239..1687276)
Genome map
AA seq 345 aa AA seqDB search
MKSAVYTKAGQVGLASIERPQIIEADDVIIRVVRACVCGSDLWRYRNPETKAGHKNSGHE
AIGIVEEAGEAITTVKPGDFVIVPFTHGCGECDACLAGFDGSCDNHIGNNLGGDFQAEYI
RFHYANWALVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAV
GQCAVIAAKMRGASQIILMSRHEDRQKMAMESGATAVVAERGQEGITKVREILGGGADAA
LECVGTEAAIEQALGVLHNGGRMGFVGVPHYNNRALGSTFMQNISVAGGAASATTYDKQF
LLKAVLDGDINPGRVFTSSYKLEDIDQAYKDMDERKTIKSMIVIE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcagtatatacaaaggcaggtcaggttggacttgctagcattgaacgtccg
caaataatagaagcggatgatgtgattattcgtgtggttcgtgcgtgcgtttgtggttca
gatttatggaggtaccgtaatccagaaacgaaagctggacacaaaaatagtggacacgaa
gcgattgggattgttgaagaagctggggaagccattacgacggtgaaaccaggtgatttt
gtgattgtcccttttacacatggatgtggtgagtgtgatgcctgtcttgctggatttgac
ggttcttgcgacaatcatattggcaataatttggggggtgattttcaggcagaatatatt
cgcttccactatgcaaactgggcgctggttaaaatccctggtcaaccttctgactataca
gaagggatgctcaagtcccttttgactcttgcagatgtcatgccgacaggctatcatgcg
gcgcgtgttgcaaatgttcaaaaaggggacaaggttgttgttatcggtgatggggctgtt
ggtcaatgtgctgtcatcgcggctaagatgcgtggagcatcacaaattatccttatgagc
cgtcatgaagaccgtcaaaagatggctatggagtcaggtgcgacagctgttgttgcagaa
cgtggtcaagaaggaattaccaaggtgcgtgaaatcctcggtggaggagcagatgcagca
cttgaatgtgttggtacggaggctgctatagaacaggcgctaggtgttcttcataatgga
gggcgtatgggctttgtaggagtcccacactataataatcgtgctcttggttcgacattt
atgcaaaatatctctgtagcaggtggggcagcttctgctacaacatacgataagcaattt
ttactaaaagccgtccttgatggtgatatcaatccaggtcgcgtctttacttcaagttat
aaactggaagatatcgaccaagcctataaagatatggatgaacgtaagacaattaagtct
atgattgtaatcgaataa

DBGET integrated database retrieval system