KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_1815Help
Entry
SPT_1815          CDS       T00875                                 

Definition
sucrose phosphorylase (Sucrose glucosyltransferase)(Glucosyltransferase-A) (GTF-A) (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPT_1815
Enzymes [BR:snt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SPT_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1724642..1726084)
Genome map
AA seq 480 aa AA seqDB search
MPIQNKTMLITYSDSLGNNLKDLYDNLEEHFGDAIGGVHLLPFFPSTGDRGFAPVDYDEV
DSAFGDWEDVKRLGERYYLMFDFMINHISRQSKYYKDYQEKHEASEFKDLFLNWDKFWPE
NRPTQSDVDLIYKRKDRAPKQEIVFEDGSVEHLWNTFGEEQIDLDVTKEVTMEFIRKTIQ
HLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKVRDIAAEYGTELLPEIHEHYS
IQFKIADHDYYVYDFALPMVTLYTLYSSRTERLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEIDYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDVKYFLARLI
QAFAPGIPQVYYVGLLAGKNDLKLLEETKEGRNINRHYYSNEEIAKEVQRSVVKALLNLF
SFRNRSEAFDLEGTTEIETPTAHSIVIKRQNKDKSVTAVAEIDLQNQTYRVIENGVEVTF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcaaaataaaaccatgttgattacctattctgatagccttggaaataatctt
aaagacttatatgataatttggaagagcattttggagatgctattggaggagttcacctt
ttaccatttttcccatcaacaggtgatcgtggatttgcgccagttgactacgacgaagtg
gactcagcttttggtgattgggaggatgttaagcgtttaggtgagagatattatcttatg
tttgattttatgattaatcatatttctcgtcaatccaagtattataaggactatcaagaa
aaacatgaagccagtgaatttaaagatctctttttaaactgggataagttttggccagaa
aaccgtccgacacagtctgatgtagatttaatttacaagcgtaaggatcgtgcaccaaag
caagagattgtgtttgaagatggttcagtggaacatttgtggaatacctttggtgaggag
cagattgatcttgatgtgaccaaagaagtaactatggaatttatccgtaagaccattcag
cacttggcaagtaatgggtgtgatttgattcgtctagatgcctttgcttatgcagtgaag
aaattggatactaatgatttctttgtggaaccagatatttgggatttattggacaaagtt
cgagatatcgctgctgagtatgggacagagcttttacctgagattcatgaacactattcg
attcagtttaaaatagcagaccatgattactatgtttatgattttgctcttccaatggtg
acactttatactctttacagttccagaacagagcgtttggctaagtggttaaagatgagc
ccgatgaagcaatttacgacgctagatacccatgatgggattggagtagtagatgtcaag
gatatcctgaccgatgaggagattgactatgcttcaaatgaactctataaggttggagcc
aatgtcaaacgtaagtactctagtgccgagtataacaacttagatatctaccaaatcaat
tcaacctactattcagcgcttggagatgatgatgtcaagtattttctcgctcgtctaatt
caagcttttgccccaggtattcctcaggtttactatgtgggtctattagcaggcaagaat
gacttgaaattattagaagaaactaaagaaggtcgaaatattaatcgtcattactatagc
aacgaggaaatagcaaaagaagtgcaacgatctgttgtgaaggcccttctcaatctattt
tctttccgtaaccgttcagaagcctttgatctagaagggactactgagatagagacacca
acagctcacagcattgtaatcaaacgtcaaaataaagataagtccgtaacagcagtagca
gaaattgatttgcaaaatcagacttatcgggtaattgagaatggagttgaagtaacattt
tga

DBGET integrated database retrieval system