KEGG   Streptococcus pneumoniae SPNA45: SPNA45_00118Help
Entry
SPNA45_00118      CDS       T02245                                 

Gene name
hasC
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPNA45_00118 (hasC)
   00052 Galactose metabolism
    SPNA45_00118 (hasC)
   00500 Starch and sucrose metabolism
    SPNA45_00118 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    SPNA45_00118 (hasC)
Enzymes [BR:snu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPNA45_00118 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(121293..122192)
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSLEDHFDSNFELEYNLKEKGKTDLLKLVDETTGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMNDYEKTHASTIAVMPVPHEDVSSYGVIAPQ
GEGSNGLYSVETFVEKPAPEETPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAID
TLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYLIQLGKELTEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagtcatccctgctgctggactaggaactcgattttta
ccagcaaccaaggcccttgccaaagaaatgttgccaatcgtagacaaaccaactatccag
tttatcgtggaagaagctctcaaatcaggtattgaagatattctagttgtcactggtaaa
tcaaaacgttctcttgaagaccactttgattcaaactttgagcttgaatacaatcttaag
gaaaaaggcaaaacggatttgttaaaattggtagatgaaacaactggcatgcgccttcat
ttcatccgccaaactcatccacgcggtctcggagatgctgttttgcaagccaaggctttc
gtcggaaatgaaccttttgtcgttatgcttggtgatgacttgatggatatcacagacgag
aaggccgttcctttgacaaaacaactgatgaatgattacgaaaagacacacgcatcaacc
attgctgtcatgcccgtaccacacgaagacgtttcatcatatggagtcattgctcctcaa
ggcgaaggaagcaatggactctatagcgttgaaactttcgttgaaaaaccagctcccgag
gagactccaagtgatttggcaatcatcggtcgctatctactcacaccagaaatttttgag
attctcgaaaagcaagctcctggtgctggaaatgaaatccaacttactgatgcaatcgat
actcttaataaaacacagcgtgtttttgcccgtgaatttacaggagctcgttacgacgtt
ggggataagtttggctttatgaaaacatctattgactacgccctcaaacatccacaagtc
aaagatgatttaaagaattacctcatccaacttggaaaagaattgactgagaaggaataa

DBGET integrated database retrieval system