KEGG   Streptococcus pneumoniae SPNA45: SPNA45_00195Help
Entry
SPNA45_00195      CDS       T02245                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Glycolysis / Gluconeogenesis
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:snu01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:snu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:snu00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:snu00650]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:snu00362]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:snu00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:snu00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:snu00621]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:snu00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
199822..202473
Genome map
AA seq 883 aa AA seqDB search
MADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLDQEQVDYIVAKASVAALDAHGEL
ALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQW
ITQTSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREKLSPV
IAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTV
NRGTEIMRAFRPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEKEWKEHSR
KLAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtgacaccagaggaaaagaaactcgttgctgaaaaacacgta
gatgagttggttcaaaaagctctagttgcccttgaagaaatgcgtaaattggatcaagag
caagttgactacatcgttgccaaagcatcagtagcagctttggatgcccacggagaattg
gctttacatgcctttgaagaaacaggacgtggtgtatttgaagataaagcaactaagaac
ttgtttgcctgtgaacacgtagtaaacaacatgcgccacactaagacagttggcgttatc
gaagaagacgatgtaaccggattgactcttattgctgaaccagttggtgttgtttgtggt
attactccaacaacaaacccaacatcaacagcaatcttcaaatcattgatttcattgaag
acacgtaacccaatcgtctttgccttccatccatcagcacaagaatcatctgctcatgca
gctcgtatcgtccgcgatgcagctatcgcagctggtgctcctgaaaactgtgtacaatgg
attactcaaacatctatggaagcaacaagtgcccttatgaaccacgaaggtgttgcgaca
atccttgcaacaggtggtaatgccatggttaaggcggcttattcatgtggtaaaccagct
cttggggtaggtgccggaaacgttccagcttatgttgaaaaatcagcaaacattcgtcaa
gcagcacacgatatcgtcatgtctaaatcatttgataacggtatggtctgtgcatctgaa
caagcagttatcattgataaagaaatttacgatgaatttgtagcagagttcaaatcttac
cacacttactttgtaaacaaaaaagaaaaagctcttcttgaagagttctgcttcggcgtc
aaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatcgttggtaaacca
gcaacttggattgcagaacaagcaggatttacagttccagaaggaacaaacattcttgct
gcagaatgtaaagaagttggcgaaaatgagccattgactcgtgaaaaattgtcaccagtt
attgccgttttgaaatctgaaagccgtgaagatggtattaccaaggctcgtcaaatggtt
gaatttaacggtcttggacactcagcagctatccacacagctgacgaagaattgactaaa
gaatttggtaaagctgttaaagctattcgtgttatctgtaactcaccttctacttttggt
ggtatcggggacgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactcagttggggataacgttagtgccattaacctcttgaatatcaaaaaagtc
ggaagacggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gattcaattcaataccttcaaaaatgtcgtgacgttgaacgtgtcatgatcgttactgac
catgccatggtagagcttggtttccttgatcgtatcatcgaacaactggaccttcgtcgc
aataaggttgtttaccaaatctttgcggatgtagaaccggatccagatatcacaactgta
aaccgtggtactgagattatgcgtgccttcagaccagataccatcatcgcactcggtggt
gggtctccaatggatgctgccaaagtaatgtggcttttctacgagcaaccagaagtggac
ttccgtgaccttgtccaaaaattcatggatatccgtaaacgtgccttcaagttcccattg
cttggtaagaagactaaattcatcgcgattccaactacatctggtacaggatctgaagta
acaccatttgccgttatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaattgtagaccctgctttggtattgacagttccaggattt
gttgctgctgatactggtatggacgtattgactcacgcgacagaagcatacgtatcacaa
atggctagtgactacactgatggtttagcacttcaagctattaaattggtctttgaaaat
ctcgaaagctcagttaagaatgcagacttccactcacgtgagaaaatgcataacgcttca
acaatcgctggtatggcctttgccaatgccttcctaggtatttctcactcaatggcccat
aagattggtgcgcaattccacacagttcacggacgtacaaatgccatcttgcttccgtac
gttatccgttacaacggtacacgtccagctaagacagcaacatggcctaagtacaactac
taccgtgcagatgaaaaataccaagatatcgcacgcatgcttggacttccagcttctact
ccagaagaaggggttgaatcttacgcaaaagctgtctacgaactcggtgaacgtattggg
atccaaatgaattttagagaccaaggaattgacgaaaaagaatggaaagaacattctcgt
aaattagccttcctggcttatgaagaccaatgttcaccagctaacccacgtcttccaatg
gtagaccatatgcaagaaatcatcgaagatgcatactatggctacaaagaaagaccagga
cgccgtaaataa

DBGET integrated database retrieval system