KEGG   Streptococcus pneumoniae SPNA45: SPNA45_00251Help
Entry
SPNA45_00251      CDS       T02245                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPNA45_00251 (murA1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPNA45_00251 (murA1)
Enzymes [BR:snu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SPNA45_00251 (murA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259666..260949
Genome map
AA seq 427 aa AA seqDB search
MDKIVVQGGDNRLVGSVTIEGAKNAVLPLLAATILASEGKTVLQNVPILSDVFIMNQVVG
GLNAKVDFDEKAHLVKVDATGDITEEAPYKYVSKMRASIVVLGPILARVGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGVKISQTAGYIEAKAERLHGAHIYMDFPSVGATQNLMMAATLA
DGVTVIENAAREPEIVDLAILLNEMGAKVKGAGTETITITGVEKLHGTTHNVVQDRIEAG
TFMVAAAMTGGDVLIRDAVWEHNRPLIAKLLEMGVEVIEEDEGIRVRSQLENLKAVHVKT
LPHPGFPTDMQAQFTALMTVAKGESTMVETVFENRFQHLEEMRRMGLHSEIIRDTARIVG
GQPLQGAEVLSTDLRASAALILTGLVAQGETVVGKLVHLDRGYYGFHEKLAQLGAKIQRI
EASDEDE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattgtggttcaaggtggcgataatcgtctggtaggaagcgtgacgatcgag
ggagcaaaaaatgcagtcctacccttgttggcagcgactattctagcaagtgaaggaaag
accgtcttgcagaatgttccgattttgtcggatgtctttattatgaatcaggtagttggt
ggtttgaatgccaaggttgactttgatgagaaagcccatcttgtcaaggtggatgctact
ggcgatatcactgaggaagccccttacaagtatgtcagcaagatgcgcgcctccatcgtt
gtattagggccaatccttgcccgtgtgggtcatgctaaggtatccatgccaggtggttgt
acgattggtagccgtcctattgatcttcatttgaaaggtctggaagctatgggggttaag
attagtcagacagctggttacatcgaagccaaggcagaacgcttgcatggcgctcatatc
tatatggactttccaagtgttggtgcaacgcagaacttgatgatggcagcgactctggct
gatggggtgacagtgattgagaatgctgcgcgtgagcctgagattgttgacttagccatt
ctccttaatgaaatgggagccaaggtcaaaggtgctggtacagagactataaccattact
ggtgttgagaaacttcatggtacgactcacaatgtagtccaggaccgtatcgaagcagga
acctttatggtagctgctgccatgactggtggtgatgtcttgattcgagacgctgtctgg
gagcacaaccgtcccttgattgccaagttacttgaaatgggtgttgaagtaattgaagaa
gacgaaggaattcgtgttcgttctcaactggaaaatctaaaagctgttcatgtgaaaacc
ttgccccacccaggatttccaacagatatgcaggctcaatttacagccttgatgacagtt
gcaaaaggcgaatcaaccatggtggagacagtttttgaaaatcgtttccaacacctagaa
gagatgcgccgcatgggcttgcattctgagattatccgtgatacagctcgtattgttggt
ggacagcctttgcagggagcagaagttctttcaactgaccttcgtgccagtgcagctttg
attttgacaggtttggtagcacagggagaaactgtggtcggtaaattggttcacttggat
agaggttactacggtttccatgagaagttggcgcagctaggtgctaagattcagcggatt
gaggcaagtgatgaagatgaataa

DBGET integrated database retrieval system