KEGG   Streptococcus pneumoniae SPNA45: SPNA45_00357Help
Entry
SPNA45_00357      CDS       T02245                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:snu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356528..357970
Genome map
AA seq 480 aa AA seqDB search
MPIQNKTMLITYSDSLGNNLKDLYDNLEEHFGDAIGGVHLLPFFPSTGDRGFAPVDYDEV
DSAFGDWEDVKRLGERYYLMFDFMINHISRQSKYYKDYQEKHEASEFKDLFLNWDKFWPE
NRPTQSDVDLIYKRKDRAPKQEIVFEDGSVEHLWNTFGEEQIDLDVTKEVTMEFIRKTIQ
HLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKVRDIAAEYGTELLPEIHEHYS
IQFTIADHDYYVYDFALPMVTLYTLYSSRTERLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEIDYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDVKYFLARLI
QAFAPGIPQVYYVGLLAGKNDLKLLEETKESRNINRHYYSNEEIAKEVQRPVVKALLNLF
SFRNRSEAFDLEGTTEIETPTAHSIVIKRQNKDKSVTAVVEIDLQNQTYRVIENGVEVTF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcaaaataaaaccatgttgattacctattctgatagccttggaaataatctt
aaagacttatatgataatttggaagagcattttggagatgctattggaggagttcacctt
ttaccatttttcccatcaacaggtgatcgtggatttgcgccagttgactacgacgaagtg
gactcagcttttggtgattgggaggatgttaagcgtttaggtgagagatattatcttatg
tttgattttatgattaatcatatttctcgtcaatccaagtattataaggactatcaagaa
aaacatgaagccagtgaatttaaagatctctttttaaactgggataagttttggccagaa
aaccgtccgacacagtctgatgtagatttaatttacaagcgtaaggatcgtgcaccaaag
caagagattgtgtttgaagatggttcagtggaacatttgtggaatacctttggtgaggag
cagattgatcttgatgtgaccaaagaagtaactatggaatttatccgtaagaccattcag
cacttggcaagtaatgggtgtgatttgattcgtctagatgcctttgcttatgcagtgaag
aaattggatactaatgatttctttgtggaaccagatatttgggatttattggacaaagtt
cgagatatcgctgctgagtatgggacagagcttttacctgagattcatgaacactattcg
attcagtttacaatagcagaccatgattactatgtttatgattttgctcttccaatggtg
acactttatactctttacagttccagaacagagcgtttggctaagtggttaaagatgagc
ccgatgaagcaatttacgacgctagatacccatgatgggattggagtagtagatgtcaag
gatatcctgaccgatgaggagattgactatgcttcaaatgaactctataaggttggagcc
aatgtcaaacgtaagtactctagtgccgagtataacaacttagatatctaccaaatcaat
tcaacctactattcagcgcttggagatgatgatgtcaagtattttctcgctcgtctaatt
caagcttttgccccaggtattcctcaggtttactatgtgggtctattagcaggcaagaat
gacttgaaattattagaagaaactaaagaaagtcgaaatattaatcgtcattactatagc
aacgaggaaatagcaaaagaagtgcaacgacctgttgtgaaggcccttctcaatctattt
tctttccgtaaccgttcagaagcctttgatctagaagggactactgagatagagacacca
acagctcacagcattgtaatcaaacgtcaaaataaagataagtccgtaacagcagtagta
gaaattgatttgcaaaatcagacttatcgggtaattgagaatggagttgaagtaacattt
tga

DBGET integrated database retrieval system