KEGG   Streptococcus pneumoniae SPNA45: SPNA45_00430Help
Entry
SPNA45_00430      CDS       T02245                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPNA45_00430 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPNA45_00430 (trpC)
Enzymes [BR:snu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SPNA45_00430 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
433030..433797
Genome map
AA seq 255 aa AA seqDB search
MSQEFLARILEQKAREVEQMKLEQIQPLRQTYRLAEFLKNHQDRLQVIAEVKKASPSLGD
INLDVDIVQQAQTYEENGAVMISVLTDEVFFKGHLDYLREISSQVNIPTLNKDFIIDEKQ
IIRARNAGATVILLIVAALAEERLKELYDYATVLGLEVLVETHNLAELEVAHRLGAQIIG
VNNRNLTTFEVDLQTSVDLAKHFKDDCLYISESAIFTGQDAERVAPYFNGILVGTALMQA
EDVAQRIKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatttttagcacgaatcttagagcagaaggcgcgtgaggtggagcagatg
aagctggagcaaatccagcctctgcgccagacctatcgcttggcagaatttttgaagaat
catcaggaccgcttgcaggtaatcgctgaggtcaagaaagctagccctagtttgggagat
atcaatctcgatgtggatattgtgcaacaggcccagacttatgaagaaaacggagcagtg
atgatttcggtgttgacagatgaagttttctttaaaggacatttggattatctacgggag
atttccagtcaggtaaacattccaacgctcaacaaggactttatcatcgatgaaaagcaa
atcatccgcgctcgcaatgcaggtgcgacagtcatcttgctcattgtggcagccttggca
gaagaacgtcttaaggaactttacgactacgcgacagtgcttggtctggaagtcttggtg
gaaactcacaatctagctgaactagaggtagcccacagacttggtgcccagattatcggg
gtcaataaccgcaacttgaccacctttgaggtcgacttgcagaccagtgtagacttggct
aaacatttcaaagatgattgcttgtacatttctgaatctgctattttcacagggcaggat
gcggaacgagtagcgccatactttaacggaattttagtagggacagctctcatgcaggca
gaggatgtggcccagagaatcaaggagttgcagattgacaaaggttaa

DBGET integrated database retrieval system