KEGG   Streptococcus pneumoniae SPNA45: SPNA45_00433Help
Entry
SPNA45_00433      CDS       T02245                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPNA45_00433 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPNA45_00433 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPNA45_00433 (trpA)
Enzymes [BR:snu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPNA45_00433 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
435577..436353
Genome map
AA seq 258 aa AA seqDB search
MPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLDGLGETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQALVETLKTIETEIPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPDLPHEHANFVEPFLADTDIALIPLVSLTTGIERQKELIEGAEGFVYAVAIN
GVTGKSGNYRADLDKHLAQLHQVADIPVLTGFGVSSQADLERFNAVSDGVIVGSKIVKAL
HQGEPIQDFIRQAVAYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacagaaaaattaaatgctataaaagcagctggaaaaggaattttt
gttccctatatcatggctggagaccacgagaaaggtttggatggactaggagaaacaatc
cactttctagaagatttgggtgtctctgcaattgaagtgggtattcccttttcagaccct
gttgcagatggacctgttatcgaagaagctggcttgcgcagtttagcccacgggacctct
acccaggctttagttgaaaccttgaaaaccattgaaacagagattccactggtcatcatg
acctacttcaaccccctctttcagtacggtgtggagaactttgtcaaagatctggctgat
acagctgtgaagggcttgattatcccagacttgcctcatgaacatgccaactttgtagaa
ccatttttggcagatacagatatcgccttgattcctttagtaagcttgaccacaggaatt
gagcgccagaaagagttgattgaaggggcggagggattcgtctatgccgttgccatcaat
ggggtgacagggaaatcaggcaattaccgtgcagatttggacaagcacttggcgcaactt
catcaagtggccgacatcccagtcttgacaggttttggtgtatctagtcaagccgatctg
gaacgcttcaatgcggtgtcagatggtgttatcgtcggttcgaaaatagtaaaagctctc
caccaaggagagccgattcaggattttatcagacaagcagtagcttaccaaaaataa

DBGET integrated database retrieval system