KEGG   Streptococcus pneumoniae SPNA45: SPNA45_00648Help
Entry
SPNA45_00648      CDS       T02245                                 

Gene name
tpi
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPNA45_00648 (tpi)
   01230 Biosynthesis of amino acids
    SPNA45_00648 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNA45_00648 (tpi)
   00051 Fructose and mannose metabolism
    SPNA45_00648 (tpi)
   00562 Inositol phosphate metabolism
    SPNA45_00648 (tpi)
Enzymes [BR:snu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPNA45_00648 (tpi)
Exosome [BR:snu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPNA45_00648 (tpi)
  Exosomal proteins of bladder cancer cells
   SPNA45_00648 (tpi)
  Exosomal proteins of melanoma cells
   SPNA45_00648 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
648341..649099
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKDSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVVADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
attgctgctccagctcttgatttgacaactgttcttgctgttgcaaaagactcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgacgaagatatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcctcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagttgctgactttggt
caagaagtcgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system