KEGG   Streptococcus pneumoniae SPNA45: SPNA45_00648Help
Entry
SPNA45_00648      CDS       T02245                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
snu00010  Glycolysis / Gluconeogenesis
snu00051  Fructose and mannose metabolism
snu00562  Inositol phosphate metabolism
snu01100  Metabolic pathways
snu01110  Biosynthesis of secondary metabolites
snu01120  Microbial metabolism in diverse environments
snu01130  Biosynthesis of antibiotics
snu01200  Carbon metabolism
snu01230  Biosynthesis of amino acids
Module
snu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNA45_00648 (tpi)
   00051 Fructose and mannose metabolism
    SPNA45_00648 (tpi)
   00562 Inositol phosphate metabolism
    SPNA45_00648 (tpi)
Enzymes [BR:snu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPNA45_00648 (tpi)
Exosome [BR:snu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPNA45_00648 (tpi)
  Exosomal proteins of bladder cancer cells
   SPNA45_00648 (tpi)
  Exosomal proteins of melanoma cells
   SPNA45_00648 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF2767
Motif
Other DBs
NCBI-ProteinID: CCM07936
Structure
PDB: 

Jmol
Position
648341..649099
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKDSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVVADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
attgctgctccagctcttgatttgacaactgttcttgctgttgcaaaagactcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgacgaagatatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcctcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagttgctgactttggt
caagaagtcgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system