KEGG   Streptococcus pneumoniae SPNA45: SPNA45_00651Help
Entry
SPNA45_00651      CDS       T02245                                 

Gene name
dyr
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPNA45_00651 (dyr)
   00670 One carbon pool by folate
    SPNA45_00651 (dyr)
Enzymes [BR:snu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SPNA45_00651 (dyr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651784..652290
Genome map
AA seq 168 aa AA seqDB search
MTKKIVAIWAQDEEGVIGKENRLPWHLPAELQHFKETTLNHAILMGRVTFDGMGRRLLPK
RETLILTRNPEEKIDGVATFQDVQSVLDWYQAQEKNLYIIGGKQIFQAFEPYLDEVIVTH
IHARVEGDTYFPEELDLSLFETVSSKFYAKDEKNPYDFTIQYRKRKEV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaaaatcgtagctatttgggcccaggatgaagagggtgtgattggtaaggaa
aatcgtctgccttggcatttgccagcagaattgcagcactttaaagaaacaactctgaat
catgctatcttgatggggcgtgtgacctttgatgggatggggcgtcgcttgcttccaaaa
cgggaaaccttgattttgacgcgtaatccggaagaaaagatagatggggttgctactttt
caggacgtccagtctgttcttgactggtatcaggctcaagaaaagaatctctacattatc
ggtgggaagcaaatttttcaggcttttgaaccttaccttgatgaagtgattgtcactcac
attcatgctcgggtggaaggagatacctatttccctgaagaacttgacttgtctcttttt
gagacagtttcaagcaaattttacgccaaagatgagaagaatccttatgattttaccatc
caataccgcaagagaaaggaagtctaa

DBGET integrated database retrieval system