KEGG   Streptococcus pneumoniae SPNA45: SPNA45_01009Help
Entry
SPNA45_01009      CDS       T02245                                 

Gene name
glkA
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPNA45_01009 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNA45_01009 (glkA)
   00052 Galactose metabolism
    SPNA45_01009 (glkA)
   00500 Starch and sucrose metabolism
    SPNA45_01009 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SPNA45_01009 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPNA45_01009 (glkA)
   00524 Butirosin and neomycin biosynthesis
    SPNA45_01009 (glkA)
Enzymes [BR:snu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPNA45_01009 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1007362..1008321
Genome map
AA seq 319 aa AA seqDB search
MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLGL
AAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAAL
GERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPISCTCG
KKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagattattgggattgaccttggtggaacttctatcaaatttgcaatctta
acaacagcaggagaaatccaaggaaagtggtcaatcaagaccaacattttggatgaggga
agtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttggattg
gcagcagcggacttccaaggcattggaatgggatcaccaggtgtggttgaccgtgacaaa
gggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaaaag
attgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagctctt
ggtgagcgctggatgggtgctggagataaccaaccagacgttgtctttatgacactcggt
actggtgttggtggtggtattgtcgcagaaggcaaattgcttcatggtgttgctggtgca
gcaggtgaacttggtcatatcactgttgactttgaccaaccaatctcatgtacttgtggt
aaaaaaggctgccttgagacagttgcttcagcaacagggattgtcaacttgactcgtcgc
tatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataacggagaagaa
gtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgattgtt
taccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatcctaaat
ccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaaggt
gttcaaaaagtttacgatgaaaatagtttcccacaagtacgcacatctactaaattagct
cttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaataa

DBGET integrated database retrieval system