KEGG   Streptococcus pneumoniae SPNA45: SPNA45_01199Help
Entry
SPNA45_01199      CDS       T02245                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPNA45_01199 (pfk)
   01230 Biosynthesis of amino acids
    SPNA45_01199 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNA45_01199 (pfk)
   00030 Pentose phosphate pathway
    SPNA45_01199 (pfk)
   00051 Fructose and mannose metabolism
    SPNA45_01199 (pfk)
   00052 Galactose metabolism
    SPNA45_01199 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SPNA45_01199 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SPNA45_01199 (pfk)
Enzymes [BR:snu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPNA45_01199 (pfk)
Protein phosphatases and associated proteins [BR:snu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPNA45_01199 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1210305..1211312
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHLLDAASVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIATGADEIIIPEAGFKMEDIVASIKAGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGT
AEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggtggagacgcccctggtatgaacgctgccatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagtgtttggtatctatgacgga
tatgctggtatggttgccggtgaaattcatctcctagatgcagcttcagtaggggacatc
atttctcgtggtggtactttccttcactcagctcgttacccagagtttgctcaacttgaa
gggcaacttaaagggattgagcaattgaaaaaacacggaattgaaggtgtagttgttatc
ggtggtgacggatcttaccacggcgctatgcgtttgactgaacatggcttcccagctatt
ggtcttccaggtacaatcgataacgatatcgttggtactgactttacaatcggttttgac
acagcggttactactgccatggacgctatcgataagattcgtgatacatcatcaagtcac
cgtcgtacttttgtaatcgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcaactggtgctgatgaaatcatcatccctgaagcaggcttcaagatggaagat
atcgtagcaagcatcaaagctggttatgaatgtggtaaaaaacacaatatcatcgtctta
gctgaaggtgtgatgtcagcggctgaatttggtcaaaaacttaaagaagctggagataca
agcgaccttcgtgtaacagaacttggacatattcaacgtggtggttctccaactgcgcgt
gaccgtgttttggcgtcacgtatgggtgcacatgctgttaaacttcttaaagaaggtatc
ggtggtgttgcggttggtattcgtaacgaaaaaatggttgaaaatccaattcttggtact
gcagaagaaggggcattgtttagccttactgcagaaggtaagattgtggttaacaacccg
cacaaagccgatattgagctatctagcttgaataagagcttgtcataa

DBGET integrated database retrieval system