KEGG   Streptococcus pneumoniae SPNA45: SPNA45_01412Help
Entry
SPNA45_01412      CDS       T02245                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPNA45_01412 (glgB)
Enzymes [BR:snu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SPNA45_01412 (glgB)
Exosome [BR:snu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPNA45_01412 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1416144..1418072
Genome map
AA seq 642 aa AA seqDB search
MDNREALKTFMTGENFYLQHYLGAHREELNGEHGYTFRVWAPNAQAVHLVGDFTNWIENQ
IPMVRNDFGVWEVFTNMAQEGHIYKYHVTRQNGHQLMKIDPFAVRYEARPGTGAILTELP
EKKWKDGLWLARRKRWGFEERPVNIYEVHAGSWKRNSDGSPYSFAQLKDELIPYLVEMNY
THIEFMPLMSHPLGLSWGYQLMGYFALEHAYGRPEEFQDFVEECHTHNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHNKAHNHGWGALNFDLGKNEVQSFLISCIKHWIDVYHLDG
IRVDAVSNMLYLDYDDAPWTPNKDGGNLNYEGYYFLQRLNEVIKLEYPDVMMIAEESSSA
TKITGMKEIGGLGFDYKWNMGWMNDILRFYEEDPIYRKYDFNLVTFSFMYVFKENYLLPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEYGQFLEWKSEEQ
LEWSNLEDPMNAKMKYFASQLNQFYKDHRCLWEIDTSYDGIEIIDADNRDQSVLSFIRKG
KKGEMLVCIFNMVPVERKDFTIGLPVAGIYEEVWNTELEEWGGVWKEHNQTVQTQEGLWK
DYEQTLTFTLPAMGASVWKIKRRLKSTKTVTNKNQKGVENEK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggataatagagaagcattaaaaacctttatgacgggtgaaaatttttatctccaacat
tatctaggagcacatagggaagaactaaatggagagcatggctataccttccgtgtttgg
gcacctaatgctcaggctgttcacttggttggtgattttaccaactggattgaaaatcag
attccaatggtaagaaatgattttggggtctgggaagtctttaccaatatggctcaagaa
gggcatatttacaaatatcatgtcacacgtcaaaatggtcatcaactgatgaagattgac
ccttttgctgtcaggtatgaggctcgtccaggaacaggggcaatcttaacagagcttcct
gagaagaaatggaaggatggactttggctggcacgaagaaaacgttggggctttgaagag
cgtcctgtcaatatttatgaagttcacgctggatcatggaaaagaaattctgatggcagt
ccttatagttttgcccagctcaaggatgaactcattccttatctcgttgaaatgaactat
actcatattgagtttatgcccttgatgtcccatcctttgggcttgagttgggggtatcag
cttatgggttacttcgctttagagcatgcttatggccgaccagaggagtttcaagatttt
gtcgaggagtgtcatacccataatattggggttattgtggactgggtaccaggtcacttt
accatcaacgatgatgccttagcctattatgatgggacaccgacttttgaataccaagat
cataataaggctcataaccatggttggggtgcccttaattttgaccttggaaaaaatgaa
gtccagtccttcttaatttcttgcattaagcattggattgatgtctatcatttggatggt
attcgtgtggatgctgttagcaacatgctctatttggactatgatgatgctccatggaca
cctaataaagatggcggaaatctcaactatgaaggttattatttccttcagcgcttgaat
gaggttattaagttagaatatccagatgtgatgatgattgcagaagaaagttcgtctgcg
accaagattacgggaatgaaagagattggtggtctaggatttgactacaaatggaacatg
ggctggatgaatgatatcctccgtttctacgaagaagatccgatctatcgtaaatatgac
tttaacctggtgactttcagctttatgtatgttttcaaggagaattatctcttgccattc
tcgcacgatgaagtggttcatggcaagaagagtatgatgcataagatgtggggagatcgt
tacaatcaatttgcaggcttgcgcaatctctatacgtaccaaatttgtcaccctggtaag
aaattgctcttcatgggtagcgaatacggtcaattcctagaatggaaatctgaagaacag
ttggaatggtctaacctagaagacccaatgaatgctaagatgaagtatttcgcttctcag
ctaaaccagttttacaaagatcatcgctgtctgtgggaaattgataccagctatgatggt
attgaaatcattgatgcggataatcgagaccagagtgttctttcctttattcgtaagggt
aaaaagggagaaatgttagtctgtatctttaatatggtacctgttgagcggaaagatttt
acaatcggactacccgttgcaggaatttacgaagaagtatggaatactgagttggaagag
tggggaggcgtttggaaagaacataatcaaactgttcaaacgcaagaaggactatggaaa
gattatgagcagaccttaacctttaccctaccggctatgggagcaagtgtatggaaaatc
aaacgtcgcttgaaatctactaaaaccgtcacaaataaaaaccaaaaaggagtagaaaat
gaaaaatga

DBGET integrated database retrieval system