KEGG   Streptococcus pneumoniae SPNA45: SPNA45_01523Help
Entry
SPNA45_01523      CDS       T02245                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:snu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(join(1549058..1550425,1550431..1550466))
Genome map
AA seq 467 aa AA seqDB search
MTIFPDDFLLIKGAYNEDGKGLSVQDVLPKGGLGEATENPTEDPTEDNLKLIGIDFYHKY
KEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKYYDELFDELHAHGIEPLVTLS
HYETPLYLARKYHGWVDRRMIHFYEKFARTVLERYKDKVKYWLTFNEVNSVLELPFTSGG
IDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEFKVGCMVLAMPAYPMTPNPKDVW
ATHEYENLNYLFSDVHVRGYYPNYAKRYFKEHDINIEFAAEDAELLKNYTVDFLSFSYYM
SVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQIDPIGLRIILNRYYDRYQIPLFIVE
NGLGAKDQLIKDELNNLTVQDDYRIQYMKEHLLQVAEALQDGVEIMGYTSWGCIDCVSMS
TAQLSKRYGLIYVDRNDDGSGTLNRYKKMSFTWYKEVIESNGESLFK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttttccagatgattttcttttaatcaagggagcatataatgaagatggtaag
ggcttatcagttcaggatgtgttacccaaaggtggattaggagaagcaacagaaaatcct
acagaagatcctacagaagataacttaaaattgataggtattgatttttatcataaatat
aaggaagatatatccttgttttctgaaatgggctttaatgtttttcgtacttctattgca
tggagtagaatttttccaaaaggagatgaagaagaacctaacgaagctggtttgaaatat
tatgatgaattgtttgatgaactacatgctcacgggatagagccacttgtaactctttca
cactatgagactccattatatttagcaagaaaatatcatggatgggttgataggagaatg
attcatttttatgaaaaatttgctcgaacagttttagaaaggtataaagataaagttaaa
tattggcttacatttaacgaagtaaactctgttttggaattaccatttactagtggagga
atagatatacctaaggagaatctttcgaaacaagaattatatcaagctatacatcatgaa
ttagtcgcctcaagtttggttacaaaaattgctcgtgagattaattcagagtttaaggtg
ggatgtatggtattagctatgccagcttatccaatgactccaaatccaaaagatgtatgg
gcgactcatgagtatgagaatctaaattatctattttcagatgtgcatgttagaggttat
tatccgaattatgcaaaaagatattttaaggaacatgacattaacatagagtttgcagct
gaagatgcagagttattaaaaaattatactgtagattttttatcctttagctattacatg
agtgtgactcaatctgctcttccaacacagtataattcaggagaagggaatattattggt
ggtttagtaaatccttatttagagtcttcagagtggggatggcaaattgatccaattgga
ctacgtataattttaaatagatattatgaccgttatcaaattccattatttatagtggaa
aacggattaggtgctaaagatcaactaataaaagatgaacttaataacttaaccgtccaa
gatgattatagaattcagtatatgaaagaacatttattgcaagttgctgaagctctacag
gatggtgttgaaattatgggctatacgtcttggggatgtattgactgtgtttctatgtcc
actgcacaactttctaaaaggtacggtctcatttatgttgatcgaaacgatgatggaagt
ggtacattaaatcgatataagaaaatgtcttttacttggtataaagaagtgattgaatca
aatggagaatccttattcaaatag

DBGET integrated database retrieval system