KEGG   Streptococcus pneumoniae SPNA45: SPNA45_01753Help
Entry
SPNA45_01753      CDS       T02245                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:snu01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:snu00010]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:snu00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:snu00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1785582..1786601
Genome map
AA seq 339 aa AA seqDB search
MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVAHGDFGQVPGRVLGHE
GIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPDGLTPAQASSITCAGVTTYKAIKEAKVEPGQWVVLYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAGLIKEKTDGGAHSAVVTAV
SKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQVIGSLVGTRKDLEEAFQFG
AEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgttgtaaatccagaaagcactggtgttgctattgaagaaaaagtactc
cgtccacttgaaactggggaagcacttgtagaagttgaatactgtggcgtttgccacacc
gacctccacgttgctcatggtgactttggtcaagtcccaggacgtgttcttgggcacgaa
ggtatcggtatcgttaaagagattgctccagatgtgaaaagccttaaagtcggtgaccgc
gtcagcgttgcttggttctttgaaggatgtggcacttgcgaatactgtacaactggtcgc
gaaaccctttgccgtacagtgaaaaatgctggctactcagtagacggtggtatggctgaa
caatgtatcgtaactgctgactatgctgtcaaagttcctgacggacttactccagcccaa
gcttcttctatcacatgtgctggagtaacaacctataaagctatcaaagaagcaaaagtt
gaaccaggccaatgggttgttctttacggtgctggtggacttggtaacctcgctgttcaa
tacgctaaaaaagtattcaatgctcatgttatcgcagtcgatatcaacaatgacaaactt
gcccttgcaaaagaagtaggcgctgacattgtgattaacggcctcgaagttgaagatgta
gctggactcattaaagaaaaaactgatggaggagctcattcagctgtcgtaaccgctgtg
tctaaagttgccttcaaccaggctgttgactccattcgtgctggtggtcgcgtcgtcgct
gttggtcttccttctgaaatgatggaactcagcatcgttaaaacagtcctcgatggaatc
caagtcatcggttctcttgtcggaactcgtaaagacttagaagaagccttccaatttggt
gcagaaggtctggtagtcccagttgttcaaaaacgtccagtagaagatgctgttgccatt
ttcgacgaaatggaaaaaggccaaatccaaggacgtatggtactcgacttcacccactaa

DBGET integrated database retrieval system