KEGG   Streptococcus pneumoniae SPNA45: SPNA45_01770Help
Entry
SPNA45_01770      CDS       T02245                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNA45_01770
Enzymes [BR:snu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPNA45_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1809901..1811280)
Genome map
AA seq 459 aa AA seqDB search
MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYYNGIGSDKTSTFYENW
ERDIELLLETGHTAFRTSIQWSRIFPQGCGKVNPQGVDFYRKVFEAIKAKGIRLLVNLYH
FDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWITFNEPIVPVEFGYFYDAH
YPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLNLTPAYPRSQHPADVKAAR
IAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEELELIRDNTVDFLGVNYYQPL
RVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIYEQGIYDIAQNIKENYGNIEW
MLTENGMGVEGEEKFRQDGMIQDDYRINFVKGHLRELHRAIEDGANCKGYLIWTFIDCWS
WLNSYKNRYGLVELDLETQERRLKKSGHWFKKLSDNNGF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctaagatttccaaaggattttgtctggggatcctctacttctggaccgcagacagaa
ggacgtgtagctggtgacggtaagggagacaatctctgggattactggttccaagtggag
ccaaatcgttactataatgggattggttcagataagacatcgactttttatgaaaattgg
gagcgggatattgagcttttgttagagactggtcacacagcctttcggacttctattcag
tggtcacggatttttccacaaggctgtggaaaagtcaaccctcaaggtgtggatttttat
cgtaaggtctttgaggctattaaggctaaaggaattcgtctgttagtcaatctctatcat
tttgatttaccttttgcccttcaagaggatggtgatggttgggaaaataaggcgacagtc
tcagcctatgaagactatgctcgtttttgttttgagacttatggagatttagtggatcaa
tggattacctttaacgagcccatcgttcctgtagaatttggttatttttatgatgcccat
tatccacataaggtggatgcagaggcagctgttaaggtagcctatcatacacaattggct
agcagccgggctgttaaggcttgccatgaacttttgcctgattccaagattgggattgtc
ctcaacttgacaccggcttatccacgtagccagcatcctgctgatgtcaaggcagctcgt
attgcggccctttttcaggcccaatctttcttagatccatctgtcttggggacttatcca
caggagttggtagaaatcttgcatgaacacggtcttttacctgatgctacagaggaagag
ttggaactcattcgtgataatacggtggacttccttggtgtgaactactatcaacctttg
cgtgttatggctcctcgatttgctaagcatccagagagtccactcttaccagaacatttt
tacgagccttatgtgatgcctggacgtaaaatcaattctcaccgtggttgggagatttat
gagcaagggatttatgacatcgcccaaaatatcaaggaaaattatggcaatattgaatgg
atgttgactgagaatggtatgggtgttgaaggggaagaaaaattccgtcaagatggaatg
attcaagatgattaccgtattaactttgtaaaaggtcatcttcgtgaacttcaccgtgcc
attgaagatggtgccaactgtaagggctacttgatttggacctttattgactgctggtca
tggctcaacagctataaaaatcgctatggtttggtcgaattagacttggaaacgcaagaa
cgtcgtctgaagaaatcaggccactggttcaaaaaattaagcgataataatggattttaa

DBGET integrated database retrieval system