KEGG   Streptococcus pneumoniae INV200: SPNINV200_00580Help
Entry
SPNINV200_00580   CDS       T02073                                 

Definition
putative beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
snv  Streptococcus pneumoniae INV200
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:snv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPNINV200_00580
Enzymes [BR:snv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPNINV200_00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66259..68046
Genome map
AA seq 595 aa AA seqDB search
MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALGFNTVETYIAWNLHEP
REGEFHFDGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGLPAWLLTKNMRIRSSDP
AYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGEDKAYLRAIRQLMEERGVT
CPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQEFFDEHGKKWPLMCMEFW
DGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGTNFGFMNGCSARGTLDLPQV
TSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLYKESMELDAIPLVEKVSLFET
LDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEERLRIIDGRDRAQLYVDGQWVK
TQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHKFLADTQRKGIRTGVCKDLHFLL
NWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEEPKDTYLDLSEFGKGVAFVNGQNL
GRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYKEEIHLTRKPTLKHIKGENL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacacgatttgagatacgagatgatttctatctcgatggaaaatcatttaagatttta
tctggtgccattcattattttagggttcctccagaggattggtatcattcgctctataac
ttgaaggctcttggttttaatacggtagagacttatattgcttggaatttacacgagcct
cgtgaaggtgagtttcattttgacggtgatctggatttagagaaatttctccaaatagcg
caggatttgggtctctacgcaattgtgcgtccgtctccatttatctgtgcggaatgggaa
ttcggtggcttaccagcttggctcttgaccaagaacatgcgaattcgctcatccgaccca
gcatatatcgaggcagttggtcgctactatgatcagttattgccaagactggtgcctcgt
ttgttggacaatggtggcaatattctcatgatgcaggttgaaaatgagtatggttcttac
ggagaagataaggcttacctgagagcgattcgacagctaatggaagagcgtggcgtaacc
tgtcctctctttacatcagatggtccatggcgagctactctgaaagctggaaccttaatt
gaagaggacctctttgtaacaggaaactttggttctaaggcaccttacaacttttcgcag
atgcaggaattctttgatgaacatggtaagaaatggccactcatgtgtatggagttctgg
gatggttggtttaatcgctggaaagaaccgattatcacacgggatcctaaggaattggca
gatgcagttcgagaggttttggaacaaggctctatcaatctttacatgttccacggtggt
acaaactttggtttcatgaatggttgctcggctcgaggaactttggacctgccacaagtt
acgtcttatgattacgatgcccttctggatgaagaaggaaatccaactgctaaatatctt
gcagtcaagaagatgatggcaacacatttttcagagtatccgcagttggaaccactctac
aaagagagtatggagttggatgctattccactagttgaaaaagtttctttgtttgaaacc
ttagatagcttgtcaagtcctgtagaaagtctctatcctcaaaagatggaggagctggga
caaagttatggctacctactttatcgaacagaaacaaactgggatgcagaagaagaaaga
cttcgtatcattgatggtcgagatagggcccagctgtatgtcgatggtcagtgggttaaa
actcaatatcagacagagattggggaagatattttttatcaaggtaaaaagaaagggcta
tctaggttagatatcttgatagaaaatatggggcgtgtcaactatgggcataagttctta
gcggatacgcaacgtaagggaattcggacaggggtctgtaaggatctgcatttcttacta
aactggaaacactatccacttccactagacaatcctgagaaaattgatttttcaaaagga
tggactcaaggacaaccagccttttacgcttatgactttacagtcgaagagccaaaagat
acttacctagacttgtctgagtttggtaagggagttgcctttgtcaatgggcagaatcta
ggacgtttttggaacgttggcccaactctctcactttatatccctcatagctatctcaag
gaaggtgccaaccgcatcattatctttgaaacagaaggtcaatataaagaagagattcat
ttaactcgtaaacctacactaaaacatataaagggggaaaacttatga

DBGET integrated database retrieval system